12,839 Free Images of Atlantic

seawateroceanshorelandscapewaveskyseascapeseasidecoastline
US Navy 051020-N-4374S-005 Sailors from Argentina, Brazil, Spain, Uruguay, and the United States participate in Maritime Interdiction Operations conducts security training as part of UNITAS 47-06 Atlantic Phase
people of the spanish navybrazil
US Navy 080718-N-1082Z-034 The Military Sealift Command fleet replenishment oiler USNS Leroy Grumman (T-AO 195) steams in the Atlantic Ocean during the Iwo Jima Expeditionary Strike Group composite unit training exercise (COMPT
usns leroy grumman (t-ao-195)ship
US Navy 080905-N-9079D-522 The Arleigh Burke-class guided-missile destroyer USS Russell (DDG 59) transits the Atlantic Ocean as part of the Abraham Lincoln Strike Group
boatsea
US Navy 110503-N-ZI300-097 Sailors aboard the guided-missile destroyer USS Nitze (DDG 94) fire a Mark 38 25mm machine gun during the Atlantic phase
shootnavy
Pier beach ocean
landscapefish
Submerged border defense
landscapewater
PRESERVED_SPECIMEN; ; microslide; ; IZ number 98773; lot count 1; Microslide 01, balsam, testis, section;
arthropodadecapoda
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98243; lot count 1; Microslide 01, balsam, frontal section; Microslide 02, balsam, frontal section; other number E;
limulus polyphemusarthropoda
Cape cod massachusetts
waterocean
Capetown aerial ocean
landscapetravel
Sand beach biscarrosse
landscapewater
Douglas A-4E Skyhawk of VA-45 escorts Soviet Tupolev Tu-16 c1972
militaryvehicle
US Navy 060829-N-5758H-001 Command Master Chief Ronald F. Bennett presents the Mid-Atlantic Regional Maintenance Center flag to Capt. Kevin B. Taylor during a Change of Command ceremony at Naval Station Norfolk
change of command ceremonies of the united states navynaval station norfolk
US Navy 031130-N-3653A-002 USS George Washington (CVN 73) Carrier Strike Group formation sails in the Atlantic Ocean
nimitz-class aircraft carriervehicle
US Navy 090427-N-2893B-002 ATLANTIC OCEAN (April 27, 2009) - USS Constitution's incoming commanding officer, Cmdr. Tim Cooper, climbs the mainmast shrouds aboard USCG Barque Eagle (WIX 327)
vehiclefish
US Navy 050730-C-3292S-531 The U.S. Coast Guard cutter USCGC Bear (WMEC 901) crashes through fourteen-foot waves off the coast of western Africa
united states navy images from the atlantic oceanwater waves splashing against ships
US Navy 061019-N-0841E-555 Capt. James R. Fisher, Naval Surface Force Atlantic chaplain, conducts training for chaplains and religious program specialists from around the region at the area-wide training at Naval Amphibious Bas
naval amphibious base little creekunited states navy chaplains
Maine Coastal Islands National Wildlife Refuge. Credit: USFWS
animalsbird
Image title: Horseshoe crab male on sandy beach limulus polyphemus Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-domain-images-pictures/cr
limulus polyphemusarthropoda
Image title: Horseshue crab limulus polyphemus Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-domain-images-pictures/crabs-and-lobsters-pub
arthropodabrown
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98231; lot count 1; Microslide 01, balsam, stomach, serial section; other number 5a-6;
snowcold
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98244; lot count 1; Microslide 01, balsam, frontal section; Microslide 02, balsam, frontal section; other number F;
limulus polyphemusarthropoda
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98244; lot count 1; Microslide 01, balsam, frontal section; Microslide 02, balsam, frontal section; other number F;
limulus polyphemusarthropoda
Arbacia punctulata (Lamarck, 1816) Arbacia punctulata (YPM IZ 031119). Digital Image: Yale Peabody Museum of Natural History; photo by Eric A. Lazo-Wasem 2014 Coordinate uncertainty in metres 13337.3
animals of massachusettsechinodermata
Earth
planetwater
Beach woman man
landscapewater
Surfer wind surfing surf
watersea
Kite surf surfer surf
watersea
Rock ocean rocky coast
landscapetravel
Sand expert watt leader fork
sandfeet
4_tankers_moored_in_the_Calandkanaal
vehiclewater
Shou Shan No.3 in Kaohsiung Harbour 20140508a
vehiclewater
Person ocean water
landscapefish
Cliff mar village
landscapetravel
Scottish travel scenery
landscapetravel
Rocks beach ballad
landscapewater
Cape cod national seashore massachusetts usa
foresttree
Cornwall coast england
watersea
Cornwall coast england
landscapewater
Cornwall coast england
watersea
Cornwall coast england
landscapewater
Beach beaches sea
watersea
Sky summer scenario
vegetableslandscape
Mosque the minaret hassan ii
africasea
Portugal nature sea
landscapetravel
Sunrise in Wildwood New Jersey with Atlantic Ocean looking northeast
watersea
San Sebastián - Portal 04
self-published workarchitecture
US Navy 070403-N-0535P-280 Ticonderoga-class cruisers USS San Jacinto (CG 56) and USS Hue City (CG 66) steam alongside USS Harry S. Truman (CVN 75) underway in the Atlantic Ocean
vehicleship
US Navy 080906-N-1082Z-295 The amphibious dock landing ship USS Carter Hall (LSD 50), the amphibious transport dock ship USS San Antonio (LPD 17), and the guided-missile destroyer USS Roosevelt (DDG 80) transit the Atlantic Oce
general views of uss roosevelt (ddg-80)sea
US Navy 080726-N-4236E-415 The visit, board, search, and seizure team assigned to the guided-missile cruiser USS Vella Gulf (CG 72) speeds through the Atlantic Ocean
vehiclewater
US Navy 050921-N-0793G-001 Four of the eight Atlantic Bottlenose dolphins, displaced following Hurricane Katrina, were found and brought to safety at Naval Construction Battalion Center (NCBC) Gulfport
marine life oceanariumboat
US Navy 090929-N-1688B-082 Sailors assigned to the guided-missile destroyer USS Cole (DDG 67) prepare to board an abandoned sailboat found drifting in the Atlantic Ocean
vehiclewater
US Navy 091008-N-1688B-027 Side-boys aboard the guided missile destroyer USS Cole (DDG 67) salute as Rear Admiral Garry White, Commander, Strike Force Training Atlantic, boards the ship
rainbow sideboyspeople
USS McCook (DD-496) underway c1943
vehicleboat
US Navy 071012-N-0194K-105 Chief of Naval Operations (CNO) Adm. Gary Roughead congratulates crew members aboard the hospital ship USNS Comfort (T-AH 20)
aboard usns comfort (t-ah-20)gary roughead in 2007
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98242; lot count 1; Microslide 01, balsam, sagittal section; Microslide 02, balsam, sagittal section; Microslide 03, balsam, sagittal sec
limulus polyphemusarthropoda
US Navy 070731-N-8923M-022 Lt. Timothy Castro shoots his boots from catapult 3 aboard the Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75) into the Atlantic Ocean
steam catapults on aircraft carriersaboard uss harry s. truman (cvn-75)
Skeleton of a cod (Gadus morhua). Image taken in the Akwarium Gdyńskie, Gdynia, Poland.
underwatermarine
Conservation units of golden lion tamarin, Rio de Janeiro state, Brazil: Blue line: São João Basin Environmental Protection Area (category V (IUCN) - Protected Landscape/Seascape) Red line: Poço das A
animalsmammals
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98239; lot count 1; Microslide 01, balsam, transverse section; Microslide 02, balsam, transverse section; Microslide 03, balsam, transver
limulus polyphemusarthropoda
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98240; lot count 1; Microslide 01, balsam, transverse section; Microslide 02, balsam, transverse section; Microslide 03, balsam, transver
limulus polyphemusarthropoda
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98241; lot count 1; Microslide 01, balsam, sagittal section; Microslide 02, balsam, sagittal section; Microslide 03, balsam, sagittal sec
limulus polyphemusarthropoda
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98241; lot count 1; Microslide 01, balsam, sagittal section; Microslide 02, balsam, sagittal section; Microslide 03, balsam, sagittal sec
limulus polyphemusarthropoda
Coastal landscape view viewpoint
landscapetravel
Pontoon holiday blue
landscapetravel
Image title: Child playing with horseshoe crab Image from Public domain images website, http://www.public-domain-image.com/full-image/people-public-domain-images-pictures/children-kids-public-domain-i
limulus polyphemusarthropoda
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98240; lot count 1; Microslide 01, balsam, transverse section; Microslide 02, balsam, transverse section; Microslide 03, balsam, transver
limulus polyphemusarthropoda
PRESERVED_SPECIMEN; ; ; microslide; ; IZ number 98242; lot count 1; Microslide 01, balsam, sagittal section; Microslide 02, balsam, sagittal section; Microslide 03, balsam, sagittal sec
limulus polyphemusarthropoda
Ceviche de caballa, typical in Piura (Peru).
platefood
The Coast Guard offers a helping hand to whales that have become entangled in fishing lines and nets. On the morning of July 24, 1998, Coast Guard Air Station Cape Cod responded to a harbormaster's ca
animalssea
US Navy 021024-N-4374S-026 Photographer's Mate 2nd Class Richard Virginia assigned to Fleet Combat Camera, Atlantic, stands ready to capture video imagery of an EP-3E Aries II assigned to the
fleet air reconnaissance squadron 1 (united states navy)people with video cameras
US Navy 051025-N-4374S-002 A Uruguayan Navy Sailor, assigned to frigate ROU General Artigas (ROU 2), monitors the sea traffic off the coast of Brazil during UNITAS 47-06
united states navy images from the atlantic ocean1962
US Navy 100117-N-4995K-083 Crew members aboard the Military Sealift command hospital ship USNS Comfort (T-AH 20) take a break from their duties to look at the Atlantic Ocean as the ship transits to Haiti
boatsea
US Navy 031003-N-5319A-003 Adm. Robert J. Natter, Commander, U.S. Atlantic Fleet, speaks during his Change of Command ceremony
change of command ceremonies of the united states navyaboard uss theodore roosevelt (cvn-71)
US Navy 100720-N-2908M-109 The Kearsarge Amphibious Ready Group lines up for a simulated strait transit. The Kearsarge Amphibious Ready Group is participating in a composite unit training exercise (COMPTUEX) off the East Coast
vehicleboat
US Navy 080709-N-1082Z-033 The Oliver Hazard Perry-class guided-missile frigate USS Underwood (FFG 36) steams in the Atlantic Ocean as part of the Iwo Jima Expeditionary Strike Group (ESG) composite unit training exercise (COMP
boatsea
US Navy 080823-N-9818V-314 Master Chief Petty Officer of the Navy (MCPON) Joe R. Campa Jr. speaks with Force Master Chief Frederick Pharr, Naval Air Force, U.S. Atlantic Fleet, as they make their way to the start line of the fo
naval station norfolkjr
Public involvement underway for the proposal to designate critical habitat for the threatened loggerhead sea turtle-NW Atlantic Ocean.August 7, 2013 Photo by Lilibeth Serrano, Public Affairs Specialis
reptilesanimals
Santa cruz beach boardwalk santa cruz usa
landscapetravel
Cornwall coast england
landscapewater
Vacation tourism famous place
landscapetravel
Amusement rides ferris wheel
landscapetravel
Thingvellir national park thingvellir continental
landscapetravel
Landscape scene nature
landscapescenes
France pilat dune pyla dune
landscapenature
Abendstimmung water by the sea
watersea
Farm animal lamb
landscapeanimals
Sharrod Neasman July 2016
sportgame
Albufeira europe beach
landscapetravel
Isles english coast
vehicletravel
Sport sol perspective
landscapevehicle
Galicia sea view by the sea
landscapetravel
Mataró - Basílica de Santa María 30
self-published workgold
The guided missile cruiser USS Vella Gulf (CG 72), left, and the guided missile destroyer USS James E. Williams (DDG 95), both assigned to Destroyer Squadron 26, travel in the Atlantic Ocean March 18, 2014 140318-N-WX580-014
general views of uss vella gulf (cg-72)sea
US Navy 071012-N-8704K-028 Chief of Naval Operations (CNO) Adm. Gary Roughead speaks to the crew of the hospital ship USNS Comfort (T-AH 20)
peoplegroup
US Navy 071012-N-0194K-354 Chief of Naval Operations (CNO) Adm. Gary Roughead speaks with crew members aboard the hospital ship USNS Comfort (T-AH 20)
gary roughead in 2007people
US Navy 111208-N-TB177-001 Rear Adm. Ted Branch, commander of Naval Air Forces Atlantic, passes through sideboys aboard the aircraft carrier USS Ge
aboard uss george h. w. bush (cvn-77)saluting people
US Navy 040821-N-2653P-012 Machinist's Mate 1st Class James Guild and Machinist's Mate 1st Class Derrick Jones, both assigned to the Auxiliary Division aboard PCU Virginia (SSN 774)
submarine interiorspeople
US Navy 091024-N-5319A-011 Lt. Amy Heck takes her watch on the bridge of the amphibious assault ship USS Nassau (LHA 4) during a general quarters drill
aboard uss nassau (lha-4)people
US Navy 090205-N-2636M-049 Sailors assigned to the multi-purpose amphibious assault ship USS Bataan (LHD 5) conduct training on pipe-patching techniques during a general quarters drill
aboard uss bataan (lhd-5)group
3901 - 4000 of 12,839 Next page
/ 129