8,647 Free Images of Attack

vehicleaircraftaviationjetnavymilitaryshipflightwaterfly
Image title: Bald eagle perched on goose pen after trying to attack goslings Image from Public domain images website, http://www.public-domain-image.com/full-image/vintage-photography-public-domain-im
animalsbird
Phoenix canariensis palm trees with a metal band to protect birds against cats that can climb in the tree to attack the young birds in their nests. Photo taken in San Agustín, Gran Canaria
plantstree
Roman era mosaic depicting a Leopard attacking an Ostrich. Exhibited on the outer wall of the National Museum, Damascus, Syria.
animalsbird
US Navy 100327-N-2389S-069 Rear Adm. Barry Bruner, commander of Submarine Group (COMSUBGRU) 10, talks to a Pearl Harbor survivor at the Veterans Affairs Hospital
united states department of veterans affairs medical centersarizona
US Navy 091005-N-1688B-039 Fire Controlman 3rd Class Billy Coffelt uses a remote console for the 25-mm gun aboard the guided-missile destroyer USS Cole (DDG 67) during a small boat attack drill
aboard uss cole (ddg-67)fire controlman
US Navy 091015-N-7705S-040 NORFOLK (Oct. 15, 2009) The Los Angeles-class attack submarine USS Newport News (SSN 750) approaches Pier 3 at Naval Station Norfolk
boatship
US Navy 110515-N-UO379-168 Aviation Boatswain's Mate (Handling) 2nd Class Ryan Hilliard guides an F-A-18C Hornet toward a catapult shuttle aboard U
aircraftvehicle
US Navy 111207-N-WP746-260 Jets perform a missing man flyover formation during the 70th anniversary of Pearl Harbor Day
militaryvehicle
US Navy 090321-N-9909C-152 Vice Adm. Bill Gortney watches through binoculars as the Los Angeles-class attack submarine USS Hartford (SSN 768) transits into Mina Salman pier in Bahrain
uss hartford (ssn-768)william e. gortney
US Navy 110606-N-TU221-555 An F-A-18F Super Hornet assigned to Strike Fighter Squadron (VFA) 22 performs an aerial refueling with an EA-6B Prowler
militaryvehicle
白衣人支持者在法庭外拉起大型横额，抗议首宗7-21白衣人暴动案法官判刑不公
street scenepavement
A-4E of VA-23 launched from USS Coral Sea (CVA-43) c1966
militaryaircraft
A-7E Corsair bursts into flames aboard USS Midway (CV-41) 1984
monochromevehicle
Lose compete competitive
winningblue
Cure electrocardiogram health care
medicinehealth
Blood Analysis blood pressure bloodstream
medicinescience
Anticoagulant blood blood agar
medicinescience
A-6E VA-95 And Tu-95RTs - 1982
militaryvehicle
F-14B VF-102 EA-6B OSW - 1998
aerial photographs of f-14 tomcat in flightoperation southern watch
US Navy 071207-N-4965F-001 U.S. Pacific Fleet barge arrives with the official party at the Kilo pier on board Naval Station Pearl Harbor prior to a joint U.S. Navy-National Park Service ceremony
vehiclewater
US Navy 071214-N-0555B-096 The Los Angeles-class nuclear-powered attack submarine USS Helena (SSN 725) and the San Antonio-class amphibious transport dock ship USS New Orleans (LPD 18) pass while conducting a submarine familiar
watersea
US Navy 080617-N-2218M-003 Twenty crewmembers of the fast-attack submarine USS Charlotte (SSN 766) practice escaping the submarine while wearing submarine escape immersion equipment (SEIE) suits
watersport
US Navy 041226-N-2984R-084 An F-A-18A- Hornet assigned to Marine Fighter Attack Squadron One One Five (VMFA-115) Silver Eagles catches one of the four arresting wires during aircraft recovery aboard USS Harry S. Truman (CVN 75)
aircraftvehicle
US Navy 091013-N-0932F-006 Machinist Mate 2nd Class Corey Stabenow inspects the deck of the Virginia-class fast-attack submarine USS Texas (SSN 775) after surfacing in the vicinity of the North Pole
watership
US Navy 090521-N-8750E-016 The Los Angeles class fast-attack submarine USS Hartford (SSN 768) returns to Naval Submarine Base New London after a month-long surface transit from Bahrain
waterboat
Ground zero ny houses
landscapebuilding
Mesopotamian - Cylinder Seal with Human-Headed Griffin Attacking a Horse - Walters 42444 - Side C
animals in art of the ancient near eastmiddle assyrian period
US Navy 100315-N-0808V-770 The Nimitz-class aircraft carrier USS Carl Vinson (CVN 70) performs tactical maneuvering exercises with the Chilean navy Sa'ar 4-class fast-attack craft Angamos and Casma
lightsea
US Navy 100707-N-7317W-019 Sailors move an EA-6B Prowler assigned to Electronic Attack squadron (VAQ) 130 onto an elevator for transport to the flight deck of the aircraft carrier USS Harry S. Truman (CVN 75)
vehiclesea
US Navy 080908-N-7668G-026 North Carolina congressman Mike McIntyre boards the Virginia-class attack submarine USS North Carolina (SSN 777) during a change of command ceremony at Naval Station Norfolk
change of command ceremonies of the united states navynaval station norfolk
Stealth air fighter
militaryarmy
Lose compete competitive
winningblue
Mutiny seafaring corsair
humanmale
Eng 22 Ladder 13 Bn 10 at 159 E85 St jeh
self-published workfacade
A3D-2 nose wheel collapse USS Saratoga
militaryvehicle
F-4N Phantoms of VFMA-323 in flight with CF-5A and CF-5B 1973
militaryvehicle
US Navy 090718-N-3610L-263 Lt. Cmdr. James Carver inspects the exterior of an EA-6B Prowler assigned to the Cougars of Tactical Electronic Warfare Squadron (VAQ) 139 before flight operations aboard the aircraft carrier USS Rona
electronic attack squadron 139 (united states navy)grumman ea-6 prowler on flight decks
US Navy 090723-N-7498L-247 Hawaii Governor Linda Lingle speaks to the press as the Virginia-class attack submarine USS Hawaii (SSN 776) arrives at its new homeport at Naval Station Pearl Harbor
united states navy images from pearl harbor2009 in pearl harbor
US Navy 110925-N-VN693-480 Aviation Boatswain's Mate (Handling) Airman Apprentice Terrance Wever, from Charleston, S.C
militaryvehicle
US Navy 100315-N-0808V-615 The guided-missile cruiser USS Bunker Hill (CG 52) and the Chilean navy Sa'ar 4-class fast-attack craft Angamos and Casma break away from the aircraft carrier USS Carl Vinson (CVN 70)
watersea
US Navy 100315-N-4774B-200 The Chilean navy Sa'ar 4-class fast-attack craft Angamos and Casma perform tactical maneuvering exercises in the Strait Of Magellan
vesselship
US Navy 110518-N-UO379-006 n F-A-18C Hornet assigned to the Death Rattlers of Marine Fighter Attack Squadron (VMFA) 323 makes its final approach on
lightnight
US Navy 030729-N-1577S-001 Lcdr. Scott Toppel, of Sunny Vale, Calif., assigned to the Black Aces of Strike Fighter Attack Squadron Forty One (VFA-41) briefs British Royal Navy Commodore Richard Leaman prior to a
strike fighter squadron 41 (united states navy)guests aboard uss nimitz (cvn-68)
US Navy 090112-N-7705S-061 Lt. Cmdr Brad Terry, left, executive officer of the Los-Angeles class attack submarine USS Boise (SSN 764), explains control room operations to Republic of Korea Navy Chief of Naval Operations Adm. Ju
submarine control roomsnaval station norfolk
US Navy 090112-N-7705S-092 Lt. Cmdr. Brad Terry, left, executive officer of the Los-Angeles class attack submarine USS Boise (SSN 764), presents a plaque with the boat's seal to Republic of Korea Navy Chief of Naval Operations
naval station norfolksubmarine interiors
US Navy 080822-N-7668G-004 The fast-attack submarines USS Norfolk (SSN 714), left, USS Newport News (SSN 750) and USS Oklahoma City (SSN 723) sit moored at Naval Station Norfolk's Pier 3 during sunset
piers at sunsetpurple sunset
US Navy 100126-N-3038W-132 Aviation Structural Mechanic 2nd Class Thida Kun performs maintenance on the nose landing gear of an EA-6B Prowler aboard the aircraft carrier USS Nimitz (CVN 68)
retractable undercarriagespeople
US Navy 100514-N-9860Y-002 Command Master Chief Don Famellos and Fleet Master Chief Petty Officer for U.S. Pacific Fleet John Minyard talk about theEA-18G Growler
militaryvehicle
US Navy 070907-N-7441H-005 Lt. Cmdr. Rich Rhinehart, executive officer of USS Norfolk (SSN 714), welcomes celebrities Raghib Rocket Ismail, Andre Reed and Jamie Farr to the attack submarine's control room
submarine control roomsnaval station norfolk
Contest compare win
winningblue
Communication software pc
technologyclock
Pc virus computer
technologyclock
F-18A Hornet Kfir and F-5E aircraft during air combat maneuvering 1989
militaryvehicle
USS George H.W. Bush (CVN 77) 140609-N-CZ979-009 (14203165577)
militaryvehicle
US Navy 060317-N-2903K-001 Petty Officer 2nd Class Paul Ryan Judi, left, and Seaman Gregory Chaney stand at attention after receiving the Navy Commendation Medal, for heroic efforts to help save a knife-attack victim's life
2006 united states navy images from naval base guamunited states navy mobile security squadron 7
US Navy 110129-N-7004H-071 An EA-18G Growler prepares to take off from USS George H.W. Bush (CVN 77)
vehiclenavy
US Navy 051114-N-9866B-184 Aviation Boatswain's Mates assigned to Air Department remove the chains from a U.S. Marine Corps AV-8B Harrier
militaryaircraft
U.S. Sailors move an EA-6B Prowler aircraft, second from front, assigned to Electronic Attack Squadron (VAQ) 134, while aircraft prepare to take off from the flight deck of the aircraft carrier USS George H.W 140826-N-CZ979-009
vehiclesea
US Navy 100812-N-6003P-134 Mass Communication Specialist 2nd Class Kilho Park, left, and Lt. John Moss fly in an EA-6B Prowler during an aerial change of command ceremony
mass communication specialistpeople
US Navy 070128-N-2659P-172 Aviation Structural Mechanic 3rd Class Charlie Blanchard, left, observes Aviation Structural Mechanic Airman Nika Hermes as she performs maintenance on an EA-6B Prowler
aboard uss john c. stennis (cvn-74)aviation structural mechanic
US Navy 070828-N-5476H-017 Sailors aboard Los Angeles-class attack submarine USS Key West (SSN 722) conduct mooring operations after pulling into Naval Station Pearl Harbor
united states navy images from pearl harbor2007 in pearl harbor
US Navy 070905-N-6106R-367 Attack submarine USS Chicago (SSN 721) transits in formation during Malabar 2007, an exercise involving Kitty Hawk and Nimitz Carrier Strike Group and ships of the navies of Australia, India, Japan, a
watership
US Navy 081212-N-7668G-026 Cmdr. John Kropcho III is presented the Legion of Merit by Rear Adm. Bruce Grooms during a change of command ceremony aboard the Los Angeles-class attack submarine USS Jacksonville (SSN 699) at Naval
change of command ceremonies of the united states navynaval station norfolk
US Navy 090521-N-8750E-139 Hospital Corpsman 1st Class Chris Yaras kisses his daughter for the first time during the return of the Los Angeles class fast-attack submarine USS Hartford (SSN 768) to Naval Submarine Base New Londo
people at naval submarine base new londonaboard uss new orleans (lpd-18)
US Navy 090521-N-8467N-002 Line handlers aboard the Los Angeles-class fast-attack submarine USS Hartford (SSN 768) cast lines ashore upon the ships return home to Submarine Base New London
watership
US Navy 080612-N-9818V-107 Master Chief Petty Officer of the Navy (MCPON) Joe R. Campa Jr. holds an all-hands call with the Sailors assigned to the fast-attack submarine USS Charlotte (SSN 776)
peoplejr
US Navy 080612-N-9818V-131 Master Chief Petty Officer of the Navy (MCPON) Joe R. Campa Jr. holds an all-hands call with Sailors assigned to the fast-attack submarine USS Charlotte (SSN 776)
peoplejr
US Navy 071207-N-0879R-078 Sailors aboard the guided-missile cruiser USS Lake Erie (CG 70) render honors to Pearl Harbor survivors during a joint U.S. Navy-National Park Service ceremony
aboard uss lake erie (cg-70)salute
Phoenix canariensis palm trees with a metal band to protect birds against cats that can climb in the tree to attack the young birds in their nests. Photo taken in San Agustín, Gran Canaria
grasstree
US Navy 100123-N-3038W-016 EA-6B Prowler launches from USS Nimitz
militaryvehicle
US Navy 100203-N-8467N-010 Chief Machinist's Mate John Graning hugs his wife and his 10 year-old daughter moments after the Los Angeles-class attack submarine USS Philadelphia (SSN 690) pulls into Submarine Base New London
father and daughterpeople
US Navy 030729-N-2143T-001 British Royal Navy Commodore Richard Leaman dons a flight suit prior to his familiarization flight in a F-A-18F Super Hornet, assigned to the Black Aces Strike Fighter Attack Squadron Forty One
flight suitpeople
US Navy 090722-N-8467N-005 ulinary Specialist 1st Class Joseph Appold hugs his wife and his 1-year-old son upon the return of the Virginia-class attack submarine USS New Hampshire (SSN 778) to Submarine Base New London
people at naval submarine base new londonpeople
AD Skyraider VA-195 USS Princeton
1 aircraftvehicle
Attacking the Right Whale, by Ambroise Louis Garneray, c. 1835, oil on canvas - Peabody Essex Museum - Salem, MA - DSC05305
vehiclewater
Plan and key. The Attack on Boulogne Oct 1804 RMG PZ6989
printing 1803
Medicine science still life
medicinescience
Contest compare win
winningblue
Wolves attack, Józef Chełmoński, 1883
paintings by józef chełmońskirealism
A-3B launch USS Saratoga CVA-60 1958
militaryvehicle
A-7A Corsair II of VA-27 about to launch from USS Constellation (CVA-64) in the Gulf of Tonkin on 27 August 1968 (NNAM.1996.253.7075.035)
militarynavy
F-8E VMFAW-235 DaNang Apr1966
militaryvehicle
US Navy 030519-N-2385R-003 An EA-6B Prowler prepares to launch from one of four steam powered catapults during flight operations on the flight deck aboard USS Nimitz (CVN 68)
aircraftvehicle
US Navy 070620-N-8119R-217 Landing signal officers watch an F-A-18E Super Hornet, assigned to the Tophatters of Strike Fighter Attack Squadron (VFA) 14, prepares to land on the flight deck
f/a-18 hornet aircraft carrier landingsf/a-18e super hornet on flight decks
US Navy 070828-N-5476H-004 Los Angeles-class attack submarine USS Key West (SSN 722) pulls alongside the pier as she returns to Naval Station Pearl Harbor
watership
US Navy 041207-N-3019M-006 Deputy Commander, U.S. Pacific Command, Vice Adm. Gary Roughead, is piped aboard the USS Arizona Memorial during the 63rd commemoration of the Dec. 7, 1941 attack on Pearl Harbor, Hawaii
uss arizona memorialpeople
US Navy 090911-N-8273J-078 Family members and friends of victims of the Sept. 11, 2001 terrorist attack on the Pentagon listen as President Barack Obama delivers remarks during a Sept. 11 remembrance ceremony at the Pentagon Me
celebritiespeople
US Navy 060617-N-0653J-002 Hawaii Governor, the Honorable Linda Lingle smashes a bottle of champagne against the sail of the Virginia-class nuclear attack submarine Pre-Commissioning Unit (PCU) Hawaii (SSN 776) during the ship'
ship christenings in the united states navychampagne bottle
US Navy 070122-N-0684R-093 An F-A-18C Hornet assigned to the Death Rattlers of Marine Fighter Attack Squadron Three Two Three (VMFA-323) launches from the flight deck of the Nimitz-class aircraft carrier USS John C. Stennis (CV
aircraftvehicle
US Navy 070518-N-2659P-280 Aviation Boatswain's Mate (Handling) 2nd Class Curtis Page awaits the next aircraft movement
aircraftflight
US Navy 040412-N-0780F-044 A U.S. Navy security patrol boat operates just aft of the Los Angeles-class attack submarine USS Dallas's (SSN 700) tailfin as the submarine is escorted into Souda Bay harbor for a brief port visit
watership
Internet anonymous binary
technologymasks
Internet anonymous binary
technologymasks
US Navy 100303-N-3885H-317 An MH-60S Sea Hawk helicopter from Helicopter Sea Combat Squadron (HSC) 9 flies alongside the Virginia-class attack submarine USS New Mexico (SSN 779)
waterboat
US Navy 100423-N-9818V-144 Master Chief Petty Officer of the Navy (MCPON) Rick West flips burgers with Culinary Specialist Seaman Mykal Martin aboard the Virginia-class attack submarine USS New Mexico (SSN 779)
submarine interiorsrick d. west
US Navy 080818-N-8273J-227 Master Chief Petty Officer of the Navy (MCPON) Joe R. Campa Jr. speaks with Sailors while visiting the Los Angeles-class fast-attack submarine USS Columbia (SSN 771)
submarine interiorsjr
US Navy 080905-N-9486C-001 Retired Machinist Mate Senior Chief Henry Kanahele, a plank owner of the fast-attack submarine USS Los Angeles (SSN 688), pins the Submarine Warfare breast insignia on his son
united states navy images from pearl harborsailor caps of the united states navy
US Navy 090219-N-9758L-176 onar Technician (Surface) 2nd Class Aaron Wellborn and Sonar Technician (Surface) 2nd Class Kyle Wilcox take a protective posture stance during a small boat attack drill
united states navy images from pearl harborblue
Contest compare win
winningblue
Contest compare win
winningblue
4501 - 4600 of 8,647 Next page
/ 87