110,450 Free Images of C

cc-zerofiles uploaded by daderotpages with mapsvehiclemilitaryaircraftnavyaviationjetaboard uss john c. stennis (cvn-74)
20180214_C-54_Skymaster_Air_Mobility_Command_Museum-1
militaryvehicle
20180214_C-124_Globemaster_Air_Mobility_Command_Museum-2
militaryvehicle
Lobed plate, c. 1750, Rouen, faience, Honolulu Museum of Art 9004.1
platebowl
Medusa by Harriet Goodhue Hosmer, c. 1854, marble - Hood Museum of Art - DSC09194
self-published workcc-zero
Mirror, New England, c. 1849 - Concord Museum - Concord, MA - DSC05905
19th-century furnitureself-published work
National Security Operations Center photograph, c. 1985 - National Cryptologic Museum - DSC07661
self-published workcc-zero
Madonna and child by the workshop of the Master of the Madonna of Pietrebais, Leuven, c. 1500-1525 - Museum M - Leuven, Belgium - DSC04915
self-published workcc-zero
Moccasins with beadwork and red cloth, Jicarilla Apache, c. 1870 - Ethnological Museum, Berlin - DSC01114
self-published workcc-zero
Flower basket from Japan, c. 1912-40, Honolulu Museum of Art
self-published work2015 photographs
Flask in Ko-Imari style, c. 1660, Arita, glazed porcelain, enamels - Gardiner Museum, Toronto - DSC00491
files uploaded by daderotcc-zero
Fishing vessel and container ship
boatsea
Obra S. C. Banco Ciudad (89)
self-published worktree
Hawk forehead mask, Tlingit, c. 1900, whale vertebrae, Heard Museum
self-published work2015 photographs
Mug with Thomas Jefferson, c. 1801 - National Museum of American History - DSC00147
self-published workcc-zero
Rosengarten-A-11-c-AugustaLuise
naturespring
Rosengarten-C-1-b-Celina
springplants
Wine Pot, c. 1670-1690, Arita, hard-paste porcelain with overglaze enamels - Gardiner Museum, Toronto - DSC00478
arita warecc-zero
Wien 10 Volkspark Laaerberg c
watertree
Wien 07 Urban-Loritz-Platz-Parkanlage c
architecturecity
Wien 05 Ernst-Arnold-Park c
architecturecity
Wien 01 Jonny-Moser-Park c
self-published worklawn
Wien 01 Haus am Schottentor c
self-published workpages with maps
Wien 22 Cholewkapark c
grasstree
Wien 09 Arbeits- und Sozialgericht c
vehiclecity
Plate with Amorous Couple, c. 1755, Chelsea, soft-paste porcelain with overglaze enamels - Gardiner Museum, Toronto - DSC00640
platefood
Plate with Bird on a Branch, c. 1750, Germany, tin-glazed earthenware with overglaze enamels - Gardiner Museum, Toronto - DSC00579
platefood
Plate, c. 1740, Meissen, hard-paste porcelain, overglaze enamels, gilding - Gardiner Museum, Toronto - DSC00925
platefood
Plate with Dragon and Fox Design, c. 1718-1735, Delft, tin-glazed earthenware, inglaze cobalt oxide - Gardiner Museum, Toronto - DSC00591
delftware in the gardiner museumcc-zero
Plate, Hochst Ceramics Factory, c. 1760-1770 - Nelson-Atkins Museum of Art - DSC08910
platebowl
Plate, c. 1740, Meissen, hard-paste porcelain, overglaze enamels, gilding - Gardiner Museum, Toronto - DSC00920
platefood
Oud-Valkenburg-Drie Beeldjes (1)
pages with mapsarchitecture
Ponte del Gaffaro (Venice) 2017-c
travelcity
Pair of Gates by Emile Robert (1860-1924), France, c. 1900, iron - Brooklyn Museum - DSC09208
self-published workcc-zero
Ruth Gleaning by Randolph Rogers, c. 1853, marble - Albany Institute of History and Art - DSC08023
self-published workcc-zero
Stop Gate at 2.18 miles with berm side on 4 mile level Georgetown on C and O Canal
landscapenature
Torremolinos - Parque de la Batería, cañones 1
cannons of parque de la bateríaself-published work
Public domain image - J1772 Level 2 charge socket on electric car
self-published workcc-zero
The engine room of Mercedes-AMG W205 C63 S
vehiclecar
Shaker style stove, c. 1800, iron - Old Colony History Museum - Taunton, Massachusetts - DSC03831
self-published workcc-zero
Sir Isaac Newton - Wedgwood, c. 1783 - Brooklyn Museum - Brooklyn, NY - DSC08937
self-published workcc-zero
Small Tureen Ladle, Burslem and Cobridge, Staffordshire, England, c. 1835, glazed earthenware - Brooklyn Museum - DSC09344
self-published workcc-zero
Square piano, Chickering, c. 1830 - National Museum of American History - DSC00078
self-published workcc-zero
Miniature mask, Edo people, Benin, c. 1500 AD, ivory - Linden-Museum - Stuttgart, Germany - DSC03918
self-published workcc-zero
Richard C. Briggs High - Norwalk, CT 065
self-published workcar
Unidentified object, Australia, c. 1912 - Etnografiska museet - Stockholm, Sweden - DSC01366
australia collection in the etnografiska museetself-published work
Vase by Emile Galle, c. 1901, glass - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany - DSC00962
self-published workcc-zero
Vase with trees, Daum Freres, Nancy, c. 1910, glass - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany - DSC00911
self-published workcc-zero
Ritmeier's C.W. Bitters, William Ritmeier, Milwaukee, Wisconsin, c. 1906 - Wisconsin Historical Museum - DSC02827
self-published workbitter
Starbucks at the corner of Front and Frederick streets, Toronto -c
shoppingcity
Tea Caddy, England (probably Bristol), c. 1750-1760 - Nelson-Atkins Museum of Art - DSC08785
tea caddycc-zero
Teapot in the Form of a Camel, Staffordshire, c. 1750-1755 - Nelson-Atkins Museum of Art - DSC08821
camel-shaped teapotscc-zero
Tennozu-Canal-2017100102
skylinewater
Tennozu-Canal-2017100101
skylinewater
Macchi C205 Veltro del 4° stormo Duca d'Aosta
aircraftvehicle
Tea service, view 4, c. 1745, Meissen, hard-paste porcelain, overglaze enamels, gilding - Gardiner Museum, Toronto - DSC00893
files uploaded by daderotcc-zero
Teapot-shaped ewer, Mindanao, Philippines, c. 1800 AD, brass, copper - Spurlock Museum, UIUC - DSC06011
self-published workcc-zero
El Morrito c
seashoreshore
C2020F3.Berlin.P1023389
lightnight
Black potterty ewer from Anatolia, c. 2000 BCE, Honolulu Academy of Arts
self-published workewer
Gaststätte Loretto. Innenansicht 1. Stock (2018)
self-published workpages with maps
Frankfurt, Hauptfriedhof, Grab adM 221-223 Scherbius
self-published workpages with maps
Frankfurt, Hauptfriedhof, Grab adM 221-223 Wagner
self-published workpages with maps
Front Facade for the Elgin and Winter Gardens theatres, Yonge Street, Toronto -c
shoppingcity
Frankfurt, Hauptfriedhof, Grab D adM 198 Dietze
self-published workarchitecture
Emerald bead from India, Mughal period, c. 1700-1750, Honolulu Academy of Arts
self-published work2011 photographs
1971_Opel_Rekord_1900_station_at_the_SPECIAAL_Auto_Evenement_Nijkerk_2011,_pic1
vehiclecar
1960-66_Chevrolet_C-10_(1)
vehiclecar
Box (birchbark with porcupine quills), Micmac, c. 1850 - Native American collection - Peabody Museum, Harvard University - DSC05480
cc-zerobrown
Home altar in Slovakian style, c. 1910 - Wisconsin Historical Museum - DSC03325
antiques in the wisconsin historical museumself-published work
Cream jug for European market, China, c. 1745, porcelain - Chazen Museum of Art - DSC02296
self-published workcc-zero
Ceremonial object in shape of staff, Kofun period, 4th century C. E
self-published workmetal
Cannon C-4 pic1
artillery in the national museum of military history (luxembourg)military
Crucifix, c. 1230-40, Italy, Pisa, Cleveland Museum of Art
self-published work2012 photographs
Angel with Tambourine, probably by Pisan, c. 1350-1370, marble - National Gallery of Art, Washington - DSC08914
angels with symphonia and tambourine, probably by pisanself-published work
Bdg Gdanska Sn-C 13 07-2013
peoplecity
Arrows and quiver, probably Tjukoktka, Ryssland, c. 1880 AD - Etnografiska museet - Stockholm, Sweden - DSC01254
self-published workwood
US Navy 110813-N-ED900-456 Hose team members listen to instructions on basic firefighting skills during a general quarters drill
aboard uss john c. stennis (cvn-74)people
US Navy 110925-N-VN693-266 Aviation Boatswain's Mate (Handling) Airman Apprentice Terrance Wever, from Charleston, S.C., participates
aboard uss john c. stennis (cvn-74)people
US Navy 040923-N-8704K-004 An Aviation Boatswain's Mate signals for a C-2A Greyhound to speed up the propeller rotation prior to launch aboard the conventionally powered aircraft carrier USS John F. Kennedy (CV 67)
militaryvehicle
US Navy 040324-N-6278K-133 A C-2A Greyhound assigned to the Rawhides of Carrier Logistics Support Squadron Four Zero (VRC-40) prepares to make an arrested landing on the flight deck aboard USS George Washington (CVN 73)
vehiclenavy
US Navy 051108-N-9866B-009 The nuclear-powered aircraft carrier USS Nimitz (CVN 68) pulls into her homeport of Naval Air Station North Island, Calif
vehicleboat
US Navy 100306-N-3038W-084 Lt. Joseph Dominguez, from Brownsville, Ore., assigned to the Providers of Carrier Logistics Support Squadron (VRC) 30, conducts a preflight inspection of a C-2A Greyhound aboard the aircraft carrier
militaryvehicle
US Navy 100325-N-6003P-799 A C-2A Greyhound assigned to the Rawhides of Fleet Logistics Support Squadron (VRC) 40 is directed into launching position aboard the Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75)
militaryvehicle
US Navy 070410-N-2659P-069 The Dauphin 35F from the French nuclear-powered aircraft carrier FNS Charles De Gaulle (R 91) takes off from the flight deck of the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
aboard uss john c. stennis (cvn-74)vehicle
US Navy 070411-N-9928E-112 Sailors fire 9mm pistols during a small-arms live fire exercise on the flight deck of the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
aboard uss john c. stennis (cvn-74)9 x 19 mm parabellum
US Navy 070418-N-2659P-064 USS John C. Stennis (CVN74) Commanding Officer, Capt. Bradley Johanson, shakes hands with the crew just after a Captain's Call in the hangar bay
lightgroup
US Navy 070424-N-2659P-243 An F-A-18C Hornet, assigned to the Death Rattlers of Marine Strike Fighter Squadron (VMFA) 323, launches from the flight deck of Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
militaryaircraft
US Navy 070829-N-9909C-002 Sailors man the rails of guided-missile destroyer USS Preble (DDG 88) as they return from a 7.5-month deployment as part of John C. Stennis Carrier Strike Group
boatship
US Navy 070908-N-1810F-010 Nicaraguan army soldiers prepare to unload supplies from a U.S. Navy C-130T aircraft during Hurricane Felix disaster relief operations
militaryvehicle
US Navy 081024-N-6538W-008 Operations Specialist 3rd Class Keegan Wigger, from Olympia, Wash., monitors air radar contacts in the Combat Direction Center aboard the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
lightdark
US Navy 090424-N-6538W-020 Gunner's Mate 3rd Class Collin Naylor, from San Jose, Calif., stands a .50-caliber machine gun force protection watch aboard the aircraft carrier USS John C. Stennis (CVN 74) as the ship transits Sing
aboard uss john c. stennis (cvn-74)gunner's mate
US Navy 070806-N-7498L-193 The Nimitz-Class aircraft carrier USS John C. Stennis (CVN 74) connects span wires and fuel hoses from the Military Sealift Command (MSC) fast combat support ship USNS Bridge (T-AOE 10) during a reple
vehicleboat
US Navy 050304-N-3241H-149 Two C-2A Greyhounds stand by in preparation for launch at the onset of flight operations aboard the Nimitz-class aircraft carrier USS Carl Vinson (CVN 70)
militaryvehicle
US Navy 100421-N-7908T-664 A sailor aboard the aircraft carrier USS George H.W. Bush (CVN 77) observes the landing of a C-2A Greyhound
militaryvehicle
US Navy 110405-N-YR391-001 Adm. John C. Harvey Jr. steps off a P-8A Poseidon after a tour while at Naval Air Station Jacksonville
militaryvehicle
US Navy 090328-N-9928E-053 An MH-60S Sea Hawk helicopter lands aboard the aircraft carrier USS John C. Stennis (CVN 74)
aircraftvehicle
Defense.gov News Photo 110303-N-6320L-091 - Petty Officer 2nd Class Mario Billote guides a C-2A Greyhound assigned to Fleet Logistics Support Squadron 40 aboard the aircraft carrier USS Carl
militaryaircraft
Defense.gov News Photo 111120-N-BT887-071 - U.S. Navy sailors signal the launch of an F A-18F Super Hornet assigned to Strike Fighter Squadron 41 aboard the aircraft carrier USS John C
uss john c. stennis (cvn-74) flight deckoperation enduring freedom
Defense.gov News Photo 120124-N-OY799-472 - U.S. Navy Airman Michael Linscott directs an F A-18E Super Hornet aircraft assigned to Strike Fighter Squadron 14 during flight operations on the
f/a-18e super hornet on flight decksf/a-18f super hornet on flight decks
ROCAF C-130H 1319 Taking off from Hualien Air Force Base 20160813b
militaryvehicle
13801 - 13900 of 110,450 Next page
/ 1105