4,306 Free Images of Cv

vehiclebwmonochromeblack and whiteaircraftmilitarynavyaviationaboard uss kitty hawk (cv-63)jet
Preflight check on aircraft aboard USS Ranger (CVA-61) in January 1968
black and whitemonochrome
HUP-3 USS Coral Sea 1961
aircraftaviation
US Navy 021207-N-1810F-002 EA-6B Prowler launches from one of four steam powered catapults on the ship's flight deck
aboard uss kitty hawk (cv-63)aircraft
US Task Force 17 underway during the Battle of the Santa Cruz Islands 1942
monochromeaircraft
Renault 4 CV foto3
vehiclecar
Renault 4 CV foto2
vehiclecar
US Navy 110606-N-GZ277-259 A formation of aircraft assigned to Carrier Air Wing (CVW) 17 fly over Nimitz-class aircraft carrier USS Carl Vinson (CV
vehiclesea
F-4B of VF-21 over USS Midway (CVA-41) off Vietnam in 1965
black and whitemonochrome
F3H-2 Demon of VF-193 lands on USS Bon Homme Richard (CVA-31) c1959
monochromeboat
US Navy 020306-N-6492H-510 USS Kennedy relieves USS Roosevelt
boatsea
US Navy 021106-N-1810F-019 F-A-18 Hornet aircraft paked on board USS Kitty Hawk
militaryvehicle
US Navy 021114-N-1810F-022 Aviation Boatswain's Mate 2nd Class Daniel Gadea from San Francisco, Calif., signals ready shoot before pushing the launch catapult button
militarynavy
US Navy 070923-N-3136P-109 Water vapor flows over the wings of two F-A-18E Super Hornets
militaryvehicle
US Navy 050111-N-5328N-015 On lookers watch as the 888-foot decommission aircraft carrier Oriskany arrives in Pensacola on Dec. 20, 2004 from Corpus Christi, Texas
vehicleflorida
US Navy 031018-N-5821P-002 Aviation Electronics Technician 3rd Class Melissa L. Mcafee of Philadelphia, Pa., signals to the SH-60F Seahawk helicopter
aircraftaviation
A-4F VA-212 landing on USS Hancock 1972
monochromepeople
USS Coral Sea - Belknap (CG-26) and Seattle (AOE-3) at Augusta Bay Sicily in 1988
uss coral sea (cv-43)vehicle
USS Oriskany (CVA-34) and USS Wisconsin (BB-64) at Sasebo in October 1953
monochromevehicle
US Navy 080717-N-7883G-006 Aviation Machinist's Mate 2nd Class Shaun Elling prepares an EA-6B Prowler engine for transport
aboard uss kitty hawk (cv-63)aviation machinist's mate
US Navy 080716-N-1062H-037 Aviation Ordnanceman Airman John Townes moves a Laser Guided Bomb Unit (GBU-16) into the aft bomb handling area elevator
aboard uss kitty hawk (cv-63)aviation ordnanceman
US Navy 080717-N-7883G-008 Aviation Machinist's Mate 2nd Class Shaun Elling prepares an EA-6B Prowler engine for transport
aboard uss kitty hawk (cv-63)aviation machinist's mate
Crocus vernus cv. Kiev1
naturespring
US Navy 120123-N-OY799-023 Airman James Campbell wipes down a window on the island aboard the Nimitz-class aircraft carrier USS John C. Stennis (CV
aboard uss john c. stennis (cvn-74)
USS Langley (CVL-27) and others enter Ulithi
vehicleship
USS Forrestal (CVA-59) underway at sea in 1957
monochromevehicle
US Navy 100927-N-4135M-032 Sailors and Marines conduct fire fighting and hose handling training aboard the aircraft carrier USS Harry S. Truman (CV
aboard uss harry s. truman (cvn-75)people
US Navy 030106-N-4142G-004 Flight deck crewmembers pose on one of four steam driven catapults after launching numerous flight missions, on the ship's flight deck
uss constellation (cv-64) flight decklandscape
US Navy 030106-N-4142G-011 Crew members line up in the ship's hangar bay to receive the first shot of Bacillusanthracis to build their immune system to Anthrax
aircraftvehicle
US Navy 070923-N-3136P-082 Two F-A-18E Super Hornets perform refueling maneuvers
militaryvehicle
USS Yorktown (CV-5) survivors aboard USS Benham (DD-397) on 4 June 1942 (80-G-32379)
black and whitemonochrome
US Navy 030923-N-1577S-001 Hospital Corpsman 3rd Class Joseph Romero from Falfurrias, Texas, injects Purified Protein Derivative
peopletexas
F8U-1 VF-32 on cat USS Saratoga (CVA-60) 1958
monochromevehicle
E-2B Hawkeye of VAW-115 folding wings on USS Midway (CVA-41) in 1971
aboard uss midway (cv-41)e-2a/b hawkeye
Rhododendron cv. Kiev Grishko 05
flowerred
A-4E of VA-55 is launched from USS Ticonderoga (CVA-14) in 1964
a-4e skyhawkvehicle
A4D-2 Skyhawk of VA-76 on USS Intrepid (CVA-11) c1961
militaryaircraft
CH-47 lands on USS Hancock (CVA-19) during evacuation of South Vietnam 1975
monochromevehicle
Douglas AD-5Q Skyraider of VAW-13 Det.L lands aboard USS Hancock (CVA-19), in 1962
aboard uss hancock (cv-19)landing signal officer
F6F-3 on USS Yorktown 1943
militaryvehicle
F-8A Crusader of VF-211 flies over USS Hancock (CVA-19), in 1963
monochromeboat
RA-5C RVAH-13 camouflaged Vietnam 1966
militaryvehicle
A-4L VA-204 landing on USS John F. Kennedy (CVA-67) 1971
aircraftvehicle
A-4E of VA-23 is launched from USS Midway (CVA-41) in February 1964
militaryaircraft
US Navy 020615-N-6492H-503 F-14
aboard uss john f. kennedy (cv-67)vehicle
US Navy 021205-N-1810F-012 giving the signal indicating the holdback bar is secured
militaryaircraft
USS Neosho (AO-143) refuels USS Lake Champlain (CVA-39) and USS Purdy (DD-734) in 1955
vehicleship
US Navy 050309-N-8704K-001 Aviation Boatswain's Mate 1st Class Robert McCray signals that the number one catapult is ready to launch a T-45A Goshawk
aboard uss john f. kennedy (cv-67)mcdonnell douglas t-45 goshawk
USS Coral Sea (CVA-43) passing under the Golden Gate Bridge on 8 November 1973
vehicleship
US Navy 100605-N-3038W-174 Adm. Patrick Walsh presents Rear Adm. John McLaughlin (Ret.) a framed replica of the Battle of Midway battle plans for the USS Midway (CV 41) Museum
uss midway museum - flight deckpatrick m. walsh
Acer japonicum cv. Aconitifolium - Longwood Gardens - DSC00749
plantsflower
F3H-2 of VF-41 landing on USS Independence (CVA-62) 1961
aircraftvehicle
KA-3B VAH-10 over USS FD Roosevelt (CVA-42) c1966
militaryvehicle
McDonnell F-4B Phantom II of VF-114 landing aboard USS Kitty Hawk (CVA-63), circa in 1963
flight deck of uss kitty hawk (cv-63)bw
McDonnell F2H-3 Banshee of VF-152 aboard USS Yorktown (CVA-10), circa in 1954
aircraftvehicle
Douglas A-1J Skyraider of VA-25 is launched from USS Coral Sea (CVA-43), circa in 1968
vietnam war in 1968ship
A3D-2-Skywarrior-VAH-6-April1958
vehiclesea
AD-1 Skyraiders of VA-6B on USS Coral Sea (CVB-43) in 1948
black and whitemonochrome
TBM-3Q on USS Shangri-La 1947
militaryaircraft
TBM-3Q wave off USS Shangri-La 1947
aircraftvehicle
T-28 launching from USS Tarawa (CVA-40) c1955
black and white photographs of aircraftaboard uss tarawa (cv-40)
TA-4J VT-25 in diamond anniversary paint 1986
aircraftvehicle
US Navy 050217-N-8704K-002 A Landing Signal Officer (LSO) signals a clear deck
landing signal officers-3b viking
A-7A VA-105 on USS Saratoga (CVA-60) elevator 1972
aboard uss saratoga (cv-60)vehicle
USS Coral Sea (CVA-43) underway in the Pacific Ocean, circa in 1972 (NNAM.1996.488.120.058)
vehicleboat
USS Forrestal (CVA-59) launches FJ-3s of VF-21 in Feburary 1956
monochromevehicle
US Navy 070823-N-7883G-006 USS Curtis Wilbur (DDG 54) transits behind USS Kitty Hawk (CV 63) during an air power demonstration in the Pacific
boatsea
USS Poncatoula (AO-148) refuels USS Hancock (CVA-19) off Vietnam in December 1968
monochromevehicle
US Navy 080725-N-3946H-063 Aviation Warfare Systems Operator 1st Class Ryan Branco inspects the hydraulics system of an SH-60F Seahawk
aboard uss kitty hawk (cv-63)people
US Navy 100605-N-3038W-077 Bill Landry salutes while the national anthem plays during a Battle of Midway commemoration ceremony aboard the USS Midway (CV 41) Museum
military salutes to flags of the united statesuss midway museum - flight deck
US Navy 080625-N-3946H-036 Machinery Repairman 3rd Class Russell Stull, of Kipton, Ohio, measures the diameter of a brass plug in the machine shop aboard the aircraft carrier USS Kitty Hawk (CV 63)
aboard uss george washington (cvn-73)
US Navy 080628-N-7883G-108 Adm. Timothy J. Keating, head of the U.S. Pacific Command, tours the flight deck aboard the aircraft carrier USS Kitty Hawk (CV 63)
aboard uss george washington (cvn-73)timothy j. keating
Several A-6 aircraft parked with EA-6 and S-3 aboard CV-67
folded wingsvehicle
F-14As on USS Constellation (CV-64) 1984
uss constellation (cv-64) flight deckvehicle
USS Bon Homme Richard (CV-31) anchored in New York harbor on 9 January 1945
vehicleboat
USS Enterprise (CV-6) off Pearl Harbor August 1944
vehicleboat
Commander J.P. Skyrud, U.S. Navy, aboard USS Ranger (CVA-61), circa in 1968
militaryarmy
F7U-3M of VA-83 on USS Intrepid (CVA-11) in 1956
militaryaircraft
F-4Bs of VMFA-531 on USS Forrestal (CVA-59) 1973
militaryvehicle
FJ-3 VF-51 on CVA-31 with folded wings 1957
vehicleboat
US Navy 040619-N-8704K-001 Boatswain Mate 3rd Class Joanna Saldana cuts the rope off a span wire aboard the aircraft carrier USS John F. Kennedy (CV 67) during an underway replenishment
aboard uss seattle (aoe-3)rope
US Navy 040917-N-4374S-006 Machinist Mate 3rd Class Mathew Jensen assigned to the aircraft carrier USS John F. Kennedy (CV 67) views a sample of fuel during an underway replenishment
aboard uss seattle (aoe-3)sample (fueling-at-sea)
US Navy 111007-N-VN693-681 Chief of Naval Operations (CNO) Adm. Jonathan Greenert departs the Nimitz-class aircraft carrier USS John C. Stennis (CV
guests aboard uss john c. stennis (cvn-74)jonathan w. greenert in 2011
US Navy 080715-N-7883G-016 Lt. Josh Hall gives a tour to pilots and enlisted personnel assigned to Canadian 409 Tactical Fighter Squadron.
royal canadian air force personnel409 squadron rcaf
Aichi-Prefectural-Okazaki-Commercial-High-School-6
2021 in okazaki, aichiself-published work
Black 1956 Citroën 11 Sport pic3
vehiclecar
US Navy 060825-N-8604L-316 Chief Machinist's Mate Alphonso Hurell from Georgetown, S.C., was named the Naval Air Forces, Pacific Fleet, Engineer of the Quarter for the second quarter of 2006
aboard uss kitty hawk (cv-63)
US Navy 021111-N-1810F-001 Aviation Ordnancemen conduct 50-caliber training on the fantail of the aircraft carrier
trafficshoot
US Navy 021109-N-1810F-024 E-A6B Prowler launches from USS Kitty Hawk catapult one
militarynavy
USS Franklin D. Roosevelt (CVA-42) arrives at the Puget Sound Naval Shipyard in March 1954
vehicleship
F3H-2N of VF-31 on USS Saratoga (CVA-60) 1958
militaryvehicle
A-3B VAH-11 landing on USS Independence (CVA-62)
vehicleship
F8U-1 VF-32 trap on USS Saratoga (CVA-60) 1958
militaryvehicle
F9F-6 Cougars of VF-103 over USS Coral Sea (CVA-43) 1954
monochromevehicle
Commander Alexander G.B. Grosvenor, U.S. Navy, aboard USS Ranger (CVA-61), circa in 1968
black and whitemonochrome
Douglas AD-7 Skyraiders of VA-95 aboard the USS Ranger (CVA-61), circa in 1961
ad-7 (a-1j) skyraidervehicle
Douglas AD-6 Skyraider of VA-25 after landing aboard USS Ticonderoga (CVA-14), in 1955
monochromevehicle
AD-4W 849 Sqn landing on USS Essex (CVA-9)
militaryvehicle
US Fast Carrier Task Force at Ulithi Atoll in February 1945
black and whitemonochrome
US Navy 030327-N-1810F-021 Aviation ordnancemen transfer GBU-31 joint defense attack munitions (JDAM) to ready Carrier Air Wing Five (CVW-5)
militaryarmy
US Navy 030327-N-1810F-024 Aviation ordnancemen transfer GBU-31 joint defense attack munitions (JDAM) to ready Carrier Air Wing Five (CVW-5) aircraft
aviation ordnancemanmilitary
2001 - 2100 of 4,306 Next page
/ 44