9,152 Free Images of Dragon

naturecc-zerocolorlizardreptilesanimalseyeswildlifefaunaoutdoors
Colorful color holiday motif
dragonfly
Pet bearded young
lizardbrown
Texura lizard reptile
lizardrock
Texura lizard reptile
lizardrock
Autumn sky blue
autumndragon
Lizard close up scale
animalslizard
North sea vacations north
dragonbeach
USS Bataan and HM-15 140712-N-NI474-162
mh-53e sea dragon
Air freshener colorful decoration
decorationcolor
Reptile nature head
animalsnature
Red fruit
berriesfood
Mythical creature serpent mythological
mythologydragon
Mythical creature serpent mythological
mythologydragon
Peel vietnam asia
fruitseating
Decoration roof asian style
architecturedragon
Religion mask barong
statuesmasks
Tinker handicraft yellow
autumndragon
Flying windscreen steering kite sailing
dragonfly
Wind the sky air
autumndragon
Traditional shrine head
dragonwater
Drakenhoofd stone oriental
stoneswater
Toys built monster
fantasymonster
Old Stock Exchange Copenhagen, pic-002
architecturecc-zero
Pontevedra - Graffiti 13
self-published workcc-zero
Unitarian Church Bearded Dragon 1
self-published workcc-zero
Dragon the game art
dragonbats
Animal biology camouflage
landscapeanimals
Animal biology camouflage
landscapeanimals
Plant Bud Close Up Flowering Plant
plantsflower
Animal biology branch
animalsnature
Dragon
fantasydragon
Animal beautiful photo biology
landscapeanimals
Animal biology camouflage
landscapeanimals
Animal camouflage colorful
landscapeanimals
Dragon fly bug
animalsnature
Edison lamp calla dragons wurz
bottleglass
Yulong Xueshan - Jade Dragon Snow Mountain near Lijiang in Yunnan
landscapenature
Plaque de ceinture dragon jade Taipei 30122016 2
self-published workcc-zero
Caveau No 1 - Rottiers Bernard Eugène Antoine - 1828
paintings of the order of saint john of jerusalemdieudonné de gozon and the dragon
Claude-Ferdinand Gaillard (French, 1834-1887), Raphael (Italian, 1483-1520) - St. George and the Dragon (1) - 1997.230 - Cleveland Museum of Art
prints in the cleveland museum of art
Claude-Ferdinand Gaillard (French, 1834-1887), Raphael (Italian, 1483-1520) - St. George and the Dragon (4) - 1997.233 - Cleveland Museum of Art
prints in the cleveland museum of art
Ambrogio Lorenzetti - Rofeno Abbey Poliptych. Saint Michael the Archangel slaying the Dragon between Saints Bartholomew an... - Google Art Project
trittico di san michele by ambrogio lorenzetti
Battle of Jena
4e régiment de dragonsdragoon
Albrecht Dürer - Saint George on Horseback (NGA 1949.1.15)
engravings of saint george and the dragon1500-1510
Dragon
charactersymbol
Dragon fly bug
animalsnature
Sign of 2017 Taipei Dragon Boat Festival 20170530
self-published workcc-zero
Girl and Standing eggs in 2017 Taipei Dragon Boat Festival 20170530
self-published workcc-zero
Crew Dragon Pad Abort Test (129171-5276)
items with otrs permission confirmedcrew dragon dragonfly
Visitors Tent at South Shore of Dajia Riverside Park in 2017 Taipei International Dragon Boat Race 20170530Na
self-published workwater
Albrecht Dürer - Saint George on Horseback (NGA 1943.3.3498)
engravings of saint george and the dragon1500-1510
P1310536 Paris VI eglise St-Sulpice chapelle Sts-Anges coupole rwk
works by eugène delacroix by bortolatto numbersaint michael and the dragon (delacroix)
Basil Valentine 1600 The Third Key p 64 AQ29 (2)
book illustrations of dragonsiii (numeral)
Taymouth Hours - BL YT13 f14r (Guy of Warwick)
taymouth hours - bl yates thomson 13medieval miniatures of knights
Unknow - Miracle of St George and the Dragon, with Scenes from his Life. Novgorod - Google Art Project
miracle of saint georgerussian museum
Leonardo da Vinci - RCIN 912658, Recto Studies of geometry, St George and the dragon, standing figures, etc
drawings by leonardo da vinci in the royal collection of the united kingdom
Drevnosti RG v5 ill 053
belongings of alexis i of russiacandelabras in art
Qifu late 19th or early 20th century, Honolulu Academy of Arts
chinese textiles in the honolulu museum of artchinese embroidery
Afresco de Pompéia 02
national museum of brazilrio de janeiro
Stundenbuch Peter II. Herzog Bretagne1
miniatures of saint michael and the dragonangels with peacock wings
Géricault - Saint George and the Dragon, 1816–17
1810s drawingsboston
Die Heiligen Georg und Mauritius-Inzigkofener Altar-WUS04429
saints george and mauritius (inzigofen altar)paintings of saint maurice
Claude-Ferdinand Gaillard (French, 1834-1887), Raphael (Italian, 1483-1520) - St. George and the Dragon (3) - 1997.232 - Cleveland Museum of Art
prints in the cleveland museum of art
Claude-Ferdinand Gaillard (French, 1834-1887), Raphael (Italian, 1483-1520) - St. George and the Dragon (2) - 1997.231 - Cleveland Museum of Art
prints in the cleveland museum of art
Marcantonio - St Margaret standing, holding a palm in her raised left hand, a dragon at her right, 1870,0625.836
engravings by marcantonio raimondi in the british museumraimondi (bartsch 118)
Fly nature insect
naturesummer
Dragon - Parco dei Mostri - Bomarzo, Italy - DSC02579
self-published worklawn
Dragon Bridge at night (Danang) - DSC02098
cityscapewater
MuMA - Costa - Sainte Marguerite en prièreFXD
15th-century paintings of christian saintsgreen dragon
Dragon trees (Dracaena draco) at the Museu do Vinho do Pico, estimated between 500-1000 anos, Lagido, Santa Luzia, municipality of Madalena, Pico, Azores (Portugal)
naturetree
Dragon trees (Dracaena draco) at the Museu do Vinho do Pico, estimated between 500-1000 anos, Lagido, Santa Luzia, municipality of Madalena, Pico, Azores (Portugal)
asparagalesplants
Forest dragon endangered nature
australianature
Wang Zhenpeng - Dragon Boat Regatta - 64.75 - Detroit Institute of Arts
14th-century paintings in the detroit institute of artschinese paintings in the detroit institute of arts
Boj z zmajem (panjska končnica)
paintings of dragonsradovljica
Paolo Uccello 047b
national galleryhistory of art
Unknown artist, Iranian - Sikandar and the Dragon - 17.450 - Rhode Island School of Design Museum
paintings in the rhode island school of design - museum of artrhode island school of design museum
County Flag of Somerset (Unofficial)
white flagred dragon
Dracaena draco aesthetic branches
crowntree
Dragoeiros (Dracaena draco), in the Garden of Florêncio Terra, Matriz, Horta, Faial (Azores), Portugal 1
asparagalesplants
Tents of 2017 Taipei Dragon Boat Festival under Dazhi Bridge 20170530nd
self-published workcc-zero
Dragons de Rouen - Tigers de Langnau, 8 août 2017 - 46
self-published workcc-zero
British Museum Chinese jade Shang dynasty Plaque Dragon with meander patterns 11022019 1504
self-published workmetal
Crew Dragon Resilience on crane
items with otrs permission confirmedfiles from nasa with known ids
Aloe plant brown anole
animalsnature
Greendragon (Arisaema dracontium) (1920) by Mary Vaux Walcott.
illustrationtree
Albrecht Dürer - A Mulher Revestida de Sol
woman of the apocalypse and the seven-headed dragon by albrecht dürergerman prints in the biblioteca nacional do brasil
Y Ddraig Goch a Ddyry Gychwyn (gcf02153)
national library of wales framed works collectionwelsh dragons
Andrea Mantegna - St George - WGA13965
paintings of saint george and the dragon15th-century paintings of saint george
Marco da Ravenna - After - A lion roaring at left, at dragon at upper right and a fox below right, Nn,7.40.13
prints by marco dente in the british museumraimondi (bartsch 405)
Henry Treffry Dunn (1838-1899) - The Theodore Watts-Dunton Cabinet, The Princess Sabra Taken to the Dragon - 1288304.3 - National Trust
paintings in national trust placeshenry treffry dunn
Sir Joshua Reynolds (1723-92) - Saint Michael the Archangel Slaying the Dragon - RCIN 405712 - Royal Collection
religious paintings in the royal collection of the united kingdompaintings by joshua reynolds
Бой Ивана Царевича со Змеем
paintings of fairy tales by victor vasnetsovmultiple heads
Unclean Spirits Issuing from the Mouths of the Dragon, the Beast, and the False Prophet - Google Art Project
ms. ludwig iii 1 (getty museum) - dyson perrins apocalypseunclean spirits
Iconographie Historique de l'Indochine Française 53
people of french indochinavietnamese dragon
JuanAntonioEscalante-Andromeda-MPrado
paintings by juan antonio de frías y escalante in the museo del prado17th-century paintings in the museo del prado
Flying sky blue
autumndragon
Forbidden city architecture beijing
ornamentchina
Forbidden city architecture beijing
ornamentchina
Forbidden city architecture beijing
ornamentchina
Water drainage stone
animalswater
2601 - 2700 of 9,152 Next page
/ 92