44,289 Free Images of Letter

cc-zerowith trademarksidewalkpavementpages with mapspostenvelopenotespapermessage
Scheveningen holland the hague
public transportvehicle
20160831Stolpersteine_Hockenheim3
self-published workletter
20190607_163136_June_2019_in_Poland
self-published workcc-zero
Adlerbastei Ulm Berblinger
self-published workletter
ТЭМ2УМ-355_(Trainpix_71216)
1990 locomotivesletter
Altenzentrum Santa Teresa, Ffm Hausen 86
sidewalkpavement
Arroyomolinos - Auditorium Municipal 3
sidewalkpavement
Anti-public drinking sign in Celbridge, Ireland
uploaded with en.wp upload wizardletter
Žarošice_-_deska_na_počest_Staré_Matky_Boží_žarošické
self-published workletter
Bad Vilbel, Ritterstraße 15, Mathilden-Quelle
self-published workletter
Bières Fontenoy enamel advertising sign
with trademarkletter
Beidel Bräu enamel advertising sign
with trademarkletter
Auto Union DKW Motorrader emaille werbeschild
letterdkw
Antonio Junior sigaren pic1
cigar boxletter
Batschari Mercedes Rein orient
cigarette tinletter
Cigarettes Muratti No 20 cigarettes tin, back
with trademarkletter
Döllnitz Denkm 1.u.2.WK
self-published workletter
Cigarettes Muratti No 19 cigarettes tin, back
with trademarkletter
Church Oberlemnitz 6
self-published workletter
Douwe Egberts pruim tabak
with trademarkletter
Darmstadt, Dieburger Straße 94a - 100, Plan
sidewalkletter
DensifyMarkham3
pavementletter
Burgos - Restaurante Casa Ojeda 13
self-published workletter
Club vloeitjes cigarettenpapier (Cigarette rolling papers) pic2
cigarette packsletter
Brighton Railway Station Tour (May 2009) (3)
self-published workletter
701_Washington_Road,_Mt_Lebanon,_2020-02-17,_03
self-published workletter
Agrež' Mill 17
self-published workletter
Cash envelope euro
businessmoney
Type business communication
businessbuttons
Kreis Ebm
circle of fifthsletter m
Envelope
envelopemessage
Display
displayred
Banknote cash currency
illustrationbusiness
Joseph Johann von Littrow an Hofrat Nürnberger 1827-03-26
joseph johann von littrow1827 letters
Porträtpaar 1H19Jh Herr mit Brief
paintings of people with letters19th-century portrait paintings
Willem Thans - Sealing a letter with wax - M.Ob.1967 MNW - National Museum in Warsaw
paintings in the national museum in warsaw
Landauer II 092 r
people with letters in artmerchants in miniatures
Otto Wagner Brief an Rudolf von Weyr 1913-04-07
1913 lettersrudolf weyr
Mikalojus Konstantinas Ciurlionis - Snow Covered Village, 1906 (Letter 1908) - 1906 (1908)
drawings by mikalojus konstantinas čiurlionis
Trompe l'oeil, door Cornelis van der Meulen
trompe l'oeil letter rackscornelis van der meulen
Letter of Eusebius to Karpianis. Alaverdi Gospels, A-484, 1, 1054
eusebius of caesareaalaverdi gospels
Letter to Waud from Samuel P. Bates LCCN2004660656
drawings (documentary) collection in the library of congressdrawings by alfred waud
The Ault & Wilborg Company, manufacturers of lithographing and letter press printing inks. LCCN2014646834
library of congress artist posters collection
Bible baptism - designed by H. Billings ; lettering eng'd by E. Tappan ; engraved by O. Pelton. LCCN2015647078
oliver pelton
Bible baptism - designed by H. Billings ; lettering eng'd by E. Tappan ; engraved by O. Pelton. LCCN2015647078
oliver pelton
Carl Rudolf Sohn Die entdeckten Liebesbriefe
people with letters in artcarl rudolph sohn
Enschede-Double Paragon Arabic letters by Gottlieb Schlegelmilch and Michael Jan de Goeje
enschedé gedenkschrift 1743-1893
Goethe Brief 1807-01-13 an Carl August Hofmann
autographs of johann wolfgang von goethe1807 letters
Carl Zewy Eine unangenehme Nachricht
paintings of sitting men reading indoorspaintings of people with letters
Goya y Lucientes, Francisco - Letter to Martín Zapater - Google Art Project
francisco de goya y lucientes
Tshirt print lettering
printing coffee
Texture brown letter Free illustrations
texturesbrown
Letters
envelopemail
Augusto Tominz Der Liebesbrief 1874
rococo revival paintings1874 paintings
Utagawa Kunisada II - Courtesan Reading Letter
art of japan in the museum of fine artsboston
Franz Joseph I Telegrammentwurf c1915
archduke hubert salvator of austriafranz joseph i of austria
Names of St Paulus and St Thomas on the Holy Crown, with the special forming of the U and T letters
holy crown of hungary
Openbare Tussenschool Letter G Amsterdam 001
prinsengrachtamsterdam
The Ault & Wilborg Company, manufacturers of lithographing and letter press printing inks. LCCN2014646833
library of congress artist posters collection
Margaret Newcastle 1664 Philosophical letters RGNb10347550.01.tp
duchess of newcastle-upon-tynefemale scientists
Okada Hankō - Letter Enclosing Flowers - 1975.268.105 - Metropolitan Museum of Art
paintings in the metropolitan museum of artokada hankō
The Ault & Wilborg Company, manufacturers of lithographing and letter press printing inks. LCCN2014646834
library of congress artist posters collection
Dolk, papperskniv, 17769 (, 1664) - Livrustkammaren - 78017
images from livrustkammarenletter opener
Hardy Heywood - The Awaited Letter
paintings of men on horsebackpaintings of people with dogs
Hans Dammann - Brief an Willy Ganske, 1917
statues of salomeautograph
Houghton Inc 7988 - letter
documents related to christopher columbusharvard university
Frontispiece to citizn Jno Nicholls's parliamentary and unparliamenty letters speeches and visions- (BM 1870,0514.2156)
satirical prints in the british museum
Anonymous - Calligraphic Exercise Showing Measurements of Individual Letters - 1998.213 - Art Institute of Chicago
paintings in the art institute of chicago
Johann Baptist Reiter Der Liebesbrief
paintings of women reading a letter1850s paintings of people
Letter to Waud from Samuel P. Bates LCCN2004660656
drawings (documentary) collection in the library of congressdrawings by alfred waud
Hand print article message
notespaper
Data input keys
internetwindow
Alphabet russian bread pastries
sweetsfood
Bar celebration restaurant
celebritiesfood
美紀
self-published workpages with maps
ส-อักษรไทย-Thai_Alphabet_Graphics_by_Trisorn_Triboon
black and whitewhite
Tlm ta 003 40654304773 o 41
signaturelogo
Tlm ta 003 40654304773 o 01
signaturelogo
Bröllopslinne. Monogram - Hallwylska museet - 87257
white textilesmonogram
Stolperstein für Günter Altmann, Taucherstrasse 6, Bautzen
january 2018 saxony photographsletter
Stolperstein für Hella Hoffmann, Bischofstrasse 15, Bischofswerda
january 2018 saxony photographsletter
Stolperstein für Isidor Nussenbaum, Siebergasse 2, Bautzen
january 2018 saxony photographsletter
Stolperstein für Marie Doernberger, Mühlenstrasse 2, Chemnitz
february 2018 in chemnitzletter
Stolperstein für Rachella Tittmann, Annenstrasse-Reitbahnstrasse, Chemnitz
pavementletter
2014년 11월 26일 과천시공영주차장 주차관리원 최기순 DSC04173
sidewalkletter
Seon railway station
sidewalktraffic
George Washington Street sign Belgrade
george washingtonletter
Katowice - Promienna-Walecznych-Józefowska
self-published workletter
Unico Piccolo, Usines van der Elst freres, Anvers, blikje, foto1
with trademarkletter
Dittersdorf, Thuringia 11
self-published workletter
Porträtt på Thukydides, grekisk historieskrivare - Skoklosters slott - 108817
portraits of menletter
Square europe symbol
symboltravel
Alphabet humanoid japan
sculpturestatues
Right marking away
arrowmark
Christmas motif heart watercolour
christmasheart
Background short important
backgroundlove
Post mail box send post einwurf
mailboxpost
Correspondence postal mailbox
metalblue
Painted road street
bicyclecycling
Write post broken heart
featherglass
6001 - 6100 of 44,289 Next page
/ 443