112,964 Free Images of Line

cc-zerovehiclepages with mapscarcitylighttrafficpavementsidewalksiskiyou line
Wave abendstimmung clouds
landscapewater
Spurge family euphorbiaceae seeds
leafseed
Sand sand beach vacations
animalstravel
Storm front monster cumulonimbus
landscapemonster
Grid electricity built structure
backgroundindustrial
US Navy 110815-N-XG305-722 Capt. Sal Aguilera, the U.S. 7th Fleet Chaplain, right, and Republic of Korea Petty Officer Park reach the finish line d
fleet antiterrorism security teamuss blue ridge (lcc-19)
US Navy 050120-N-0962S-140 A Sailor lining the street cordon down Pennsylvania Avenue salutes the American flag as it passes during the Inauguration Day Parade held in Washington, D.C
people with the national flag of the united states in backgroundpeople of the united states navy
US Navy 060829-N-3714J-032 Master-at-Arms 2nd Class Kristen J. Maxwell instructs patients to stand in line while waiting to be seen by a doctor at a local clinic
master-at-armspeople
US Navy 040313-N-4374S-006 A Sailor assigned to the Arleigh Burke-class destroyer USS Roosevelt (DDG 80) tosses a forward line to Sailors aboard the fast-attack submarine USS Toledo (SSN 769)
watership
U.S. Sailors assigned to the amphibious transport dock ship USS Denver (LPD 9) tow a line while conducting a replenishment at sea with the fleet replenishment oiler USNS Rappahannock (T-AO 204) in the East China 140327-N-ZU025-032
usns rappahannock (t-ao-204)aboard uss denver (lpd-9)
US Navy 100324-N-7948C-252 Aviation Ordnanceman Airman Raymond Thomas detaches the span line as Boatswain's Mate 2nd Class Bradley Gnage assists during an underway replenishment
vehiclewater
US Navy 110210-N-6006S-054 Gunner's Mate Seaman William Stafford fires a shot line from USS Bunker Hill (CG 52) to USNS Henry J. Kaiser (T-AO 187)
vehiclewater
US Navy 100915-N-5538K-128 Marines assigned to the 31st Marine Expeditionary Unit (31st MEU) carry a 600-foot Kevlar mooring line to the fantail of
peoplerope
US Navy 100610-N-5319A-133 Seaman Tecara Gray, left, Boatswain's Mate 3rd Class Renee Cabrales, Boatswain's Mate Seaman Ashley Sowells and Boatswain's Mate 3rd Class Maraalysa Maneru heave aboard the forward lines aboard USS Ne
aboard uss new orleans (lpd-18)
US Navy 070113-N-5345W-039 An aircraft director keeps a close eye on the landing area foul line as an F-A-18F Super Hornet pulls away in the background after executing a touch-and-go on the flight deck of the Nimitz-class aircr
aircraftvehicle
US Navy 070203-N-4965F-004 Sailors lay out mooring lines on the flight deck of guided missile destroyer USS Russell (DDG 59) prior to getting underway from Naval Station Pearl Harbor
aboard uss russell (ddg-59)waterfront
US Navy 070406-N-1635S-005 Mass Communication Specialist Seaman Zachary Hawkins from Virginia Beach, Va., left, rehearses his lines prior to filming a newscast aboard USS Ronald Reagan (CVN 76)
mass communication specialistsony video cameras
US Navy 090702-N-4774B-048 Sailors aboard amphibious transport dock ship USS New Orleans (LPD 18) stand by while receiving a fuel line from fleet replenishment oiler USNS Tippecanoe (T-AO 199) during an underway replenishment
aboard uss new orleans (lpd-18)
US Navy 070719-N-5253W-002 Construction Electrician Constructionman John Kinghorn, of Naval Mobile Construction Battalion Seven (NMCB 7), runs lines through the frame of a tension fabric structure at the Ikego Housing Compound
construction electrician (united states navy)yokosuka naval base in the 2000s
US Navy 070720-N-1752H-030 Local citizens wait in line to receive a checkup during a medical and dental civil action program at the Man Thai Ward Medical Station in Da Nang in support of Pacific Partnership 2007
people of da nangnón lá
US Navy 070317-N-3642E-217 Machinist's Mate 2nd Class Mark Cygnarowicz tends a safety line so the Secretary of the Navy (SECNAV), the Honorable Dr. Donald C. Winter can board USS Alexandria (SSN 757)
arctic oceanpeople
US Navy 070317-N-3642E-210 Machinist's Mate 2nd Class Mark Cygnarowicz tends a safety line so the Secretary of the Navy (SECNAV), the Honorable Dr. Donald C. Winter can board USS Alexandria (SSN 757)
uss alexandria (ssn-757)arctic ocean
US Navy 050504-C-3721C-345 Crew members stationed aboard the U.S. Coast Guard Cutter Valiant (WMEC 621), pass a fuel line to an HH-65 Dolphin helicopter crew during a training exercise in the Gulf of Mexico
eurocopter hh-65/mh-65 dolphinuscgc valiant (wmec-621)
US Navy 080108-N-8607R-045 Capt. Brad Conners, commanding officer of the Naval Base Ventura County (NBVC), speaks with Rear Adm. Robert J. Bianchi, commander, Navy Exchange Service Command, on the flight line at NBVC Point Mugu
pacific missile test center point mugurobert j. bianchi
US Navy 071208-N-9520G-003 Thousands of Japanese visitors wait in line for a chance to tour America's only permanently forward-deployed aircraft carrier USS Kitty Hawk (CV 63) during the Grand Illumination
aboard uss kitty hawk (cv-63)city
US Navy 070914-N-4965F-011 Two Sailors pull on a line to bring the brow of Indonesian naval training ship KRI Dewaruci to the pier of Naval Station Pearl Harbor
vehiclewater
Quahaug farm of Z. A. Howes at Wellfleet. Several hundred bushels of seed quahaugs are planted between the tide lines. The boundaries of the grant are market with stakes, made of slender salpings topp
pavementanimals
Tree swallows nest in tree cavities and nest boxes lined with grass, moss, rootlets and feathers of other species. We observed this one at Necedah National Wildlife Refuge in Wisconsin carrying feathe
animalsbird
Little colorado potato beetle on the putting green of a golf course near Bamberg/Germany
chrysomelidaecoleoptera
US Navy 100124-N-8241M-179 An MV-22 Osprey assigned to the Golden Eagles of Marine Medium Tiltrotor Squadron (VMM) 162 taxis to the flight line at the airfield at Naval Station Guantanamo Bay
aircraftvehicle
US Navy 091121-N-8335D-120 Electronics Technician 3rd Class Joshua Taylor strains on a mooring line as the mine counter-measures ship USS Defender (MCM 2) arrives in Chinhae for Exercise Clear Horizon
shipnavy
US Navy 100209-N-6006S-029 The Military Sealift Command fleet replenishment oiler USNS Leroy Grumman (T-AO 195) sends fuel lines over to the Nimitz-class aircraft carrier USS Carl Vinson (CVN 70) during a refueling-at-sea
aboard uss carl vinson (cvn-70)
US Navy 091010-N-0555B-037 Lt. Cmdr. Don Cross, a submarine officer from Merritt Island, Fla., carries the Navy flag across the finish line of the 2009 Ford Ironman World Championship in Kailua-Kona, Hawaii
flags of the united states navyflag of the united states
US Navy 030426-N-3228G-008 A Naval Station Pearl Harbor line-handler helps moor USS Paul Hamilton (DDG 60) during the ship's homecoming
united states navy images from pearl harborpeople at pearl harbor
US Navy 090520-N-2638R-002 Sailors remove a mooring line from a bollard as the aircraft carrier USS George Washington (CVN 73) departs Commander, Fleet Activities Yokosuka for a scheduled underway
aboard uss george washington (cvn-73)yokosuka naval base in the 2000s
US Navy 091005-N-9123L-012 The Military Sealift Command fleet replenishment oiler USNS Walter S. Diehl (T-AO-193) sends a fuel line to Sailors aboard the guided-missile destroyer USS McCampbell (DDG 85)
boatsea
Road Edge
backgroundstones
Road Edge
backgroundstones
Road Edge
backgroundstones
Wien 10 Laxenburger Straße 031 a
vehiclecity
Wien Linie 31 13 Matthäus-Jiszda-Straße a
self-published workvehicle
Doulaincourt, tracé ancien chemin de fer, rue Ernest Lorin, inventeur-constructeur 1862-1914
self-published worklawn
The frontview of the all line-up of roadster Ryuhi Final
vehiclecar
KMB-038 Volvo Alfa Regio in Nyomár
vehiclecar
HLD-874 Ikarus C56 in Miskolc
self-published workvehicle
Naqada II wavy-handled vessel, clay with painted lines - Redpath Museum - McGill University - Montreal, Canada - DSC08116
self-published workcc-pd-mark
Omura Mikicity Hyogopref Hyogoprefectural road 23 Miki shisoh Line
sidewalkpavement
Nissan Serena Rider Performance Spec Black Line S-Hybrid rear
vehiclecar
Moscow metro Akademichesjaya entrance 2019-05
self-published worktown
Pinelawn Memorial Park jeh
pavementlawn
RZD Vesyegonsk - Sonkovo train 2020-12 DM62-1745
wintertree
Shenzhen Metro Line 11 Hongshuwan S Sta Platform 2
vehiclecar
Shenzhen Metro Line 5 Minzhi Sta Platform
vehiclecar
Singwitz 2012-05-28-7712
2012 in landkreis bautzengreen
Singwitz 2012-05-28-7688
2012 in landkreis bautzengreen
Signal Gantry on LIRR before Jamaica Station
skylinetravel
Spoorlijn Groningen - Leeuwarden Roodeschool Delfzijl Drachten
vehiclecar
2019_09_Javorový
landscapenature
0084_August_9th,_2016_in_Moscow
peoplecity
2273_February_2018_in_Erfurt
pavementvehicle
20190313_082036_Legionowa_Street_in_Białystok
trafficcar
Ветка_Панки_-_Дзержинский,_путь_в_конце_ветки_2021
self-published workgreen
900_South_Station_2
sidewalkpavement
20200727_123928_Plac_Jana_Pawła_II_July_2020
self-published workpages with maps
Marching Band of Naval Academy Line up in Keelung Naval Pier before Program 20140327a
self-published workcc-zero
Lomza tourist train2
vehiclecar
CKC-651 Ikarus E94 in Mezőnyárád
self-published workvehicle
AB Tango Klasse 2
vehiclecar
Straßenbahnwagen 2823 Dresden
self-published workvehicle
Riga tram 35076 2020-03 line 3
vehiclecity
Helpers SSW 8965, 9285, and 9381 passing Semaphore 6166 near Comstock, OR on July 20, 1982 (32985244372)
trafficoregon
Helpers SSW 8965, 9285, and 9381 passing Semaphore 6166 near Comstock, OR on July 20, 1982 (33142113505)
vehicleoregon
Roger's Six-photo Sequence at Siskiyou Summit Tunnel (33024836872)
wintersnow
Roger's Six-photo Sequence at Siskiyou Summit Tunnel (33053612811)
wintersnow
SP 8234 passing the semaphores at MP 632.3 east of Walker, OR in July 1982 (33196780846)
trafficlight
SP 8233 in the Siskiyou Mountains between Riddle and Myrtle Creek, OR on July 30, 1982 (32778286800)
vehicleoregon
SP Depot at Medford, OR, currently houses a first class restaurant, Porters Dining at the Depot www.porterstrainstation.com , taken in July 1982 (33081928852)
vehiclecar
BMT 49 NB RC concourse jeh
architectureinside
Bridge of Allan railway station
vehiclecar
20190207_172032_Płyćwia
lightnight
4th_and_King_Station_3004_11
self-published workvehicle
Cliff St substation IND snow jeh
wintersnow
CPW W104 IND 3d rail house jeh
self-published workcentral park west
Fényvillamos 3
vehicletraffic
DUD-923 Ikarus 260 in Békéscsaba
self-published workvehicle
DB 182 023-2 frisch geputzt mit S-Bahn S1 im Bahnhof Bad Schandau
passenger trainvehicle
Scene life busy
businesstravel
Silhouette sky sunset
industrialtree
Silhouette sky sunset
industrialtree
Auto embarkation goppenstein valais
traincar
Art independent anywhere
vehiclenature
Stockholm - uppsala electric locomotive series rc6
sandwichvehicle
Trail bicycle bike
landscapetree
Facade house skyscraper
buildingcity
Steel high voltage pylon
architecturetechnology
City urban architecture
buildingskyline
Himmel water nature
buildingtravel
Cff ffs lok 2000
vehicletrain
Explosion background mood
backgroundfireworks
June 2800m col de la bonette
landscaperock
16501 - 16600 of 112,964 Next page
/ 1130