10,150 Free Images of Prepare

vehicleboatshipfoodseanavyaircraftmilitarywateraroma
US Navy 091109-N-7498L-072 More than 40 Sailors assigned to the guided-missile destroyer USS Chafee (DDG 90) and various commands clean the Navy Veterans Cemetery in Honolulu in preparation for Veteran's Day, Nov. 11
united states navy images from honoluluuss chafee (ddg-90)
US Navy 091115-N-1291E-116 Chief Explosive Ordnance Disposal Technician Joe Grupe, prepares a C4 satchel charge to clear moored mines during a joint nations exercise in the Persian Gulf
explosive ordnance disposal mobile unit 11united states navy in the persian gulf
US Navy 090715-N-9520G-030 Marines assigned to the 31st Marine Expeditionary Unit (31st MEU) deployed to the amphibious assault ship USS Essex (LHD 2) prepare to patrol in light armored vehicles
vehiclecar
US Navy 090711-N-9712C-008 FA-18s prepare to break formation
militaryvehicle
US Navy 080711-N-3285B-036 Store Keeper 2nd Class Carlos Bell (left) and a crew member of the Italian submarine ITS Salvatore Todaro (S-526) assist in line-handling as the boat prepares to pull into port at Naval Station Maypor
people at naval station mayportsalvatore todaro (s 526)
US Navy 080828-N-3392P-169 Amphibious assault vehicles prepare to embark aboard the amphibious dock landing ship USS Carter Hall (LSD 50)
vehiclewater
US Navy 080723-N-2959L-050 Mineman 3rd Class Damien Drolet, left, and Seaman Colby Cook prepare for push-ups with their Basic Crewman Training (BCT) classmates at Naval Amphibious Base, Coronado
push-upmineman
US Navy 070808-N-4954I-008 Cryptographic Technician (Technical) Seaman Sarah Curl carries rolls of plastic sheeting in preparation for a community relations project at Modilon General Hospital in support of Pacific Partnership
united states navy images from papua new guineaaboard uss peleliu (lha-5)
US Navy 070809-N-0989H-039 Mineman 1st Class April Morehouse assigned to the High Speed Vessel (HSV) 2 Swift prepares to load medical supplies that were donated by Project Handclasp
us navy in puerto barriosmineman
US Navy 070814-N-1229B-061 Aviation Boatswain's Mate (Equipment) Airman Joel Hernandez Jr. prepares the catapults for launching aircraft aboard Nimitz-class aircraft carrier USS Abraham Lincoln (CVN 72)
equipmentvehicle
US Navy 070820-N-8157C-155 Nimitz-class aircraft carrier USS John C. Stennis (CVN 74) passes the USS Arizona Memorial in Pearl Harbor as she prepares to pick up family and friends for a Tiger Cruise
vehicleboat
US Navy 070705-N-6278K-035 From left, Jean Muench and Diane Speranza, both of Project Hope, prepare to check an infant's vital signs at the Dr. Juan A. Nunez Policentro de Salud Hospital
project hopepanama
US Navy 070712-N-8923M-043 Sailors prepare for an M-240 machine gun shoot on the fantail aboard Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75)
aboard uss harry s. truman (cvn-75)people with ammunition belts
US Navy 071028-N-4014G-002 Members of the visit, board, search, and seizure (VBSS) team aboard guided-missile destroyer USS Porter (DDG 78) prepare their gear in case they must board a pirated vessel
vessels of the united states sixth fleetvehicle
US Navy 110428-N-4776G-892 Sailors from the Senegalese navy prepare to board the Spanish navy offshore patrol vessel SPS Centinela (P 72) during a
vehiclewater
China travel tea set green tea
drinkschina
Protein pastry brush bake
christmasfood
Bread toast meal
kitchenfood
Plant spring aroma
naturespring
Spring aroma perfume
butterflyspring
Plant macro nature
naturespring
Eat gedeckter table meal
kitchenfood
Purchasing spring aroma
springfood
Spanish dish dinner
vegetablesfish
Eu hunger food
platefood
Spring aroma perfume
landscapespring
Preparation of ZDF new year TV show at Brandenburg gate 2020-12-30 04
lightcity
US Navy 090710-N-9950J-722 ailors assigned to the amphibious assault ship USS Essex (LHD 2) move a CH-46E Sea Knight helicopter on the ship's flight deck during force integrated training in preparation for exercise Talisman Sab
aboard uss essex (lhd-2)ch-46 sea knight
Spring aroma perfume
naturespring
Old italian coffee machine make coffee italy
drinkscoffee
Old italian coffee machine make coffee italy
drinkscoffee
Kebab grill eat
vegetablesfood
Dirty man human
jewelleryfood
Candy tart cake decorations
berriesfood
Defense.gov News Photo 110715-N-XQ375-398 - Seaman Matt Binnie left and Seaman Lucio Robles prepare to attach a cargo net to an MH-60S Sea Hawk helicopter during a vertical replenishment
defense.gov news media for july 2011navy
The amphibious transport dock ship USS Denver (LPD 9), right, prepares to receive fuel during a replenishment at sea with the fleet replenishment oiler USNS Rappahannock (T-AO 204) in the East China Sea 140327-N-ZU025-048
usns rappahannock (t-ao-204)ship
U.S. Sailors with Naval Mobile Construction Battalion (NMCB) 25 prepare to test air quality with an M256 chemical agent detector kit during a simulated chemical attack during chemical, biological 140214-N-JP566-103
m256 chemical agent detector kitoperation enduring freedom
3d Tactical Fighter Squadron A-7D Corsair II 70-982 preparing to taxi
militaryvehicle
US Navy 050715-N-0413R-015 Airman Richard Vananne and Aviation Boatswain's Mate 3rd Class Max Melgar prepare to swap-out a de-fuel cart in the hangar bay aboard the nuclear-powered aircraft carrier USS Nimitz (CVN 68)
aboard uss nimitz (cvn-68)city life
US Navy 040901-N-0962S-109 Chief petty officer (CPO) selectees dress off in formation while preparing for marching drills next to the U.S. Navy's sail ship USS Constitution
united states navy images from massachusettsuss constitution in 21st century
US Navy 041031-N-5345W-058 A door gunner aboard an SH-60 Seahawk prepares for landing aboard USS Harry S. Truman (CVN 75)
door gunnerpeople
US Navy 030412-N-1050K-040 U.S. Navy Seabees attached to Amphibious Construction Battalions One and Two (ACB-1, ACB-2) prepare to place the next pile in the building of the Elevated Causeway System-Modular (ELCAS-M) structure
amphibious construction battalion 1camp patriot
US Navy 040222-N-4374S-003 An S-3B Viking prepares to land aboard the aircraft carrier USS John F. Kennedy (CV 67)
militaryvehicle
US Navy 050907-N-9866B-003 A U.S. Marine Corps CH-53E Super Stallion helicopter prepares to for landing aboard the amphibious assault ship USS Peleliu (LHA 5)
militaryaircraft
US Navy 051025-N-0780F-001 The guided missile destroyer USS Mitscher (DDG 57) prepares to arrive at Souda Bay's Marathi NATO Pier Facility for a routine port visit on the Greek island of Crete
boatship
US Navy 101116-N-3620B-006 Deck department Sailors aboard the amphibious transport dock ship USS Denver (LPD 9) make preparations to moor the ship
boatsea
US Navy 070617-N-5033P-113 Aviation boatswain's mates aboard amphibious assault ship USS Kearsarge (LHD 3) direct an A-V-8B Harrier in preparation to take off during flight operations
militarynavy
US Navy 090210-N-8534H-002 Volunteer income tax assistance (VITA) member Boatswain's Mate 1st Class William Burch, left, looks on as Culinary Specialist 3rd Class Eteinne Mendizabal prepares his 2008 Federal and State Taxes
culinary specialist (united states navy)yokosuka naval base in the 2000s
US Navy 090215-N-8517C-676 An F-A-18C Hornet prepares for an arrested landing aboard USS John C. Stennis (CVN 74)
militaryaircraft
US Navy 110327-N-7293M-188 Staff Sgt. Garrett Fillingham prepares to wash down the main rotors on an HH-60G Pave Hawk helicopter aboard the amphibi
aboard uss ponce (lpd-15)operation odyssey dawn
US Navy 110704-N-GL340-058 An F-A-18E Super Hornet assigned to the Argonauts of Strike Fighter Squadron (VFA) 147 prepares to launch from the airc
vehiclenavy
US Navy 110208-N-7981E-168 Sailors assigned to Strike Fighter Squadron (VFA) 81 prepare an F-A-18E Super Hornet for a mission aboard the Nimitz-cla
f/a-18e super hornet on flight decksaboard uss carl vinson (cvn-70)
US Navy 100830-N-6720T-047 Aviation Boatswain's Mate (Equipment) Airman Martin Vories, from Lakewood, Wash., removes a rubber seal while preparing for aircraft launches during flight operations
aviation boatswain's mateequipment
US Navy 100908-N-7680E-316 Landing Craft Utility (LCU) 1657 prepares to enter the well deck of USS Iwo Jima (LHD 7)
well deck1970
US Navy 081128-N-2456S-049 Aviation Boatswain's Mate (Fuels) Melanie Anaya, from Bronx, N.Y., cleans floor mats on the flight deck in preparation for the upcoming Maintenance Material Management (3M) inspection aboard the aircr
sweepingfuel
US Navy 080828-N-3392P-167 Amphibious assault vehicles prepare to embark aboard the amphibious dock landing ship USS Carter Hall (LSD 50)
vehiclewater
US Navy 080910-N-6266K-026 Air Force personnel assigned to the 6th Medical Group out of McDill Air Force Base, Tampa, Fla. and volunteers from the Disaster Medical Assistance Team (DMAT) assist in the evacuation of patients
naval air station corpus christistryker stretchers
US Navy 081111-N-1082Z-005 The Military Sealift Command fleet ocean tug USNS Catawba (T-ATF 168) prepares to conduct a personnel transfer with the guided-missile cruiser USS Vella Gulf (CG 72), not pictured
boatsea
US Navy 090514-N-5345W-042 Marines assigned to the 22nd Marine Expeditionary Unit (22 MEU) board the amphibious dock landing ship USS Fort McHenry (LSD 43) during final preparations for deployment while pier side at Camp Lejeun
aboard uss fort mchenry (lsd-43)gangways (watercraft)
US Navy 090610-N-1062H-044 Sailors pull in a mooring line aboard the aircraft carrier USS George Washington (CVN 73) in preparation for the ship's first summer deployment since arriving at Fleet Activities Yokosuka, Japan
yokosuka naval base in the 2000speople
US Navy 090929-N-1688B-076 Sailors assigned to the guided-missile destroyer USS Cole (DDG 67) prepare to board an abandoned sailboat found drifting in the Atlantic Ocean
waterfish
US Navy 061219-N-1522S-003 Master-at-Arms 3rd Class Leslie Orand and Master-at-Arms 2nd Class Denique Glenn, assigned to Naval Station Mayport Security Military Working Dog Unit, prepare holiday care packages for two of their d
people at naval station mayportmaster-at-arms
US Navy 070105-N-1713L-042 Sailors remove rat guards as the guided missile cruiser USS Vella Gulf (CG 72) prepares to get underway from Naval Station Norfolk
warships at naval station norfolkaboard uss vella gulf (cg-72)
US Navy 060615-N-XXXXG-002 Explosive Ordnance Disposalman 2nd Class Michael J. Nisi, assigned to Explosive Ordnance Disposal Mobile Unit Five (EODMU-5), Detachment (Det.) 51, prepares to do a mine-shape recovery
explosive ordnance disposal mobile unit 5mine countermeasures exercise
US Navy 060608-N-8110K-020 The Guided-missile frigate USS Underwood (FFG 36) prepares to moor for port visit to the city of Boston
waterboat
US Navy 061113-N-3729H-083 An F-A-18C Hornet from the Death Rattlers of Marine Fighter Attack Squadron Three Two Three (VMFA-323) prepares to launch from a steam driven catapult during flight operations aboard the nuclear-power
aboard uss john c. stennis (cvn-74)
US Navy 070305-N-6710M-006 A landing craft air cushion (LCAC) prepares to enter the well deck of amphibious transport dock USS Juneau (LPD 10) while conducting LCAC operations
vehicleship
US Navy 070305-N-6710M-013 A landing craft air cushion (LCAC) prepares to enter the well deck of amphibious transport dock USS Juneau (LPD 10) while conducting LCAC operations
boatsea
US Navy 070314-N-8923M-017 USS Harry S. Truman (CVN 75) Mustang Association members Lt. Cmdr. Eugene Mincey, left, and Ensign Scott Metcalf prepare breakfast in the kitchen of the Ronald McDonald House
lunchfood
US Navy 070427-N-4856G-026 Lt. (Dr.) Andrew Baldwin, of Lancaster, Pa., stationed at Mobile Diving and Salvage Unit (MDSU) 1, prepares to be dunked
mobile diving and salvage unit 1dunk tank
US Navy 070517-N-7163S-003 Lt. Cmdr. Brian Danielson and the Veterans Color Guard from Kenyon, Minn., render honors as the remains of Danielson's father, Air Force Maj. Benjamin Danielson, are prepared for transportation
2007 at minneapolis-saint paul international airportunited states navy images from minneapolis
US Navy 070521-N-8923M-442 A V-22 Osprey prepares to land on the flight deck of amphibious assault ship USS Wasp (LHD 1)
militaryvehicle
US Navy 060607-N-7526R-004 Cmdr. James Hineline, air boss, assigned aboard the Nimitz-class aircraft carrier USS Ronald Reagan (CVN 76), looks over the flight deck as Sailors prepare for flight operations in the South China Sea
primary flight control of uss ronald reagan (cvn-76)
US Navy 070406-N-0775Y-110 Range Safety Officer, Gunnery Sgt. Chad McKee, a Marine attached to Naval Mobile Construction Battalion (NMCB) 3 prepares to give Seabees the order to fire two Anti Tank Rocket (AT4) launchers
militaryarmy
US Navy 070427-N-4856G-020 Lt. (Dr.) Andrew Baldwin, of Lancaster, Pa., stationed at Mobile Diving and Salvage Unit (MDSU) 1, prepares to be dunked
mobile diving and salvage unit 1dunk tank
US Navy 070203-N-4965F-016 A Sailor assigned to Naval Station Pearl Harbor releases a mooring line for guided missile destroyer USS Russell (DDG 59) as the ship prepares to get underway
shipnavy
US Navy 070217-N-7130B-012 As the sun rises over the flight deck of USS Ronald Reagan (CVN 76), an aircraft maintainer prepares an F-A-18C Hornet for a day of flight operations
aircraftvehicle
US Navy 070226-N-6710M-002 Three Landing Craft Air Cushions (LCAC) prepare to enter the well deck of dock landing ship USS Tortuga (LSD 46) after conducting LCAC maintenance turns
vehiclewater
US Navy 070913-N-1003P-032 Senior Chief Eric Clark, of Explosive Ordnance Disposal Mobile Unit 8, Det. 20, based in Sigonella, Italy, prepares expired munitions for disposal
djiboutiarta
US Navy 070923-N-0194K-036 Two Sailors prepare to secure cargo to an MH-60S Seahawk, attached to Helicopter Sea Combat Squadron (HS) 28, to support a Military Sealift Command hospital ship USNS Comfort (T-AH 20) humanitarian mi
aboard usns comfort (t-ah-20)
US Navy 071030-N-0000X-081 Sailors prepare to raise an injured crew member of North Korean cargo vessel Dai Hong Dan up to the deck of guided-missile destroyer USS James E. Williams (DDG 95)
vehiclewater
US Navy 071107-N-0455L-006 A plane director gives directional signaling to an F-A-18E Super Hornet in preparation for launch from Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75)
f/a-18e super hornet on flight decksaboard uss harry s. truman (cvn-75)
US Navy 111001-N-VN693-654 An F-A-18F Super Hornet assigned to the Black Aces of Strike Fighter Squadron (VFA) 41 prepares to land on the flight de
boatsea
US Navy 111009-N-VN693-670 Sailors prepare an E2-C Hawkeye assigned to the Golden Hawks of Airborne Early Warning Squadron (VAW) 112 for launch
aircraftvehicle
US Navy 111014-N-UO379-128 An F-A-18E Super Hornet assigned to the Argonauts of Strike Fighter Squadron (VFA) 147 prepares to land aboard the aircr
aircraftaviation
US Navy 100809-N-3589B-410 Sailors man the rails aboard USS John S. McCain (DDG 56) as the ship prepares to moor pierside in Da Nang, Vietnam
boatsea
US Navy 110923-N-MW330-268 A landing craft air cushion prepares to embark the amphibious transport dock ship USS Denver (LPD 9) moored at West Army
boatsea
USS Northampton (CA-26) prepares to tow USS Hornet (CV-8) during the Battle of the Santa Cruz Islands on 26 October 1942 (80-G-304517)
waterboat
US Navy 120213-N-JN664-180 Sailors assigned to the Kestrels of Strike Fighter Squadron (VFA) 137 prepare an F-A-18E Super Hornet for launch on the
strike fighter squadron 137 (united states navy)f/a-18e super hornet on flight decks
US Navy 091023-N-5319A-004 Sailors prepare to release the lines to the amphibious assault ship USS Nassau (LHA 4) before the ship departs for a three-week Composite Unit Training Exercise (COMPTUEX)
aboard uss nassau (lha-4)naval station norfolk
US Navy 080717-N-1745W-045 Aviation Boatswain's Mate 2nd Class Jose Villarreal prepares to fire a 9mm pistol during a live-fire exercise aboard the Nimitz-class aircraft carrier USS Abraham Lincoln (CVN 72)
firearms training on uss abraham lincoln (cvn-72)aviation boatswain's mate
US Navy 100703-N-7191M-010 Aviation Boatswains Mate (Handling) 1st Class Andres Bonilla from Miami Beach, Fla., holds an up and over line in preparation for decorating the aircraft carrier USS George Washington (CVN 73) for the
vehiclenavy
US Navy 100407-N-1688B-049 Members of the honor guard aboard the aircraft carrier USS Dwight D. Eisenhower (CVN 69) prepare to fire a rifle volley during a memorial service for Lt. Steven Zilberman
three-volley saluteblack and white
US Navy 100427-N-7908T-212 Sailors aboard the aircraft carrier USS George H.W. Bush (CVN 77) wash down the flight deck during a scrubbing exercise in preparation for the ship's first Friends and Family Day Cruise
aboard uss george h. w. bush (cvn-77)number 77 on watercraft
US Navy 100513-N-0869H-013 Culinary Specialist 2nd Class Demontray Braswell, left, and Personnel Specialist 3rd Class Wendall Nelson prepare tomato brochette samples for patrons of Kitchen Engine, a local cooking products shop
washingtonfood
US Navy 070723-N-1883H-003 Amphibious command ship USS Blue Ridge (LCC 19) prepares to enter port upon the ship's return to Commander, Fleet Activities Yokosuka
vehicleboat
US Navy 080625-N-0841E-033 Former Top Chef contestant, Otto Borsich, lends a hand preparing a meal during a recent visit to the amphibious transport dock ship USS San Antonio (LPD 17)
lunchfood
US Navy 100127-N-2475A-042 Sailors load magazine clips in preparation of an M-16 gun qualification shoot aboard the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
people with magazines (firearms)m16 and stanag magazines
MACHINE_OBSERVATION; Preparations: Image only; Biorepository; Eostichopus arnesoni Cutress & Miller, 1982; Individual count: 0; Type status: (no data); Identified by: (no data); Event date: 2015
animalsfood
Deer season has begun on the Tongass, and forest visitors should consider wearing bright colors. Also, be prepared for increased traffic on forest roads and more boats using docks that access national
animalsnature
4401 - 4500 of 10,150 Next page
/ 102