3,003 Free Images of Serpent

serpent mound kentucky usacc-zeroanimalsfiles uploaded by daderotsnakereptilescc-pd-markwildlifevipernature
Jar with serpent, Nubia, Semna South cemetery, tomb N-224, Meroitic Period, 200 BC to 300 AD, ceramic, paint - Oriental Institute Museum, University of Chicago - DSC08050
self-published workcc-zero
Codex-style vase with seated figure (old god emerging from the mouth of a serpent), Mexico or Guatemala, Maya, 600-800 AD, earthenware and pigment - De Young Museum - DSC00683
self-published workcc-zero
Mackenheim StEtienne16 (cropped)
19th-century church paintings in bas-rhinbrass serpent
Rattlesnake
animalssnake
Creepy viper design
animalsicons
EscudoOcomo
unspec svg created with inkscapeself-published work
Snake
animalssnake
Infant Hercules and the Serpent, attributed to Gerard van Opstal, Franco-Flemish, mid 1600s, ivory - California Palace of the Legion of Honor - DSC07755
self-published workcc-zero
Ouroboros
circlesnake
Reptile animal nature
animalsnature
Physiotherapy symbol
medical symbolsnake
Image title: Puerto Rican boa snake with tongue shown epicrates inornatus Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-domain-images-pict
reptilesanimals
Lion Attacking a Serpent, perhaps by A. Bouché fils, undated, bronze - Middlebury College Museum of Art - Middlebury, VT - DSC08145
self-published workcc-pd-mark
Loie Fuller, serpent dancer, by Pierre Roche, 1900 - Bode-Museum - DSC02839
self-published workcc-pd-mark
Check out this close up from Port Louisa National Wildlife Refuge in Iowa! Garter snakes eat small prey including worms, minnows, leeches and rodents. Photo by Jessica Bolser/USFWS.
reptilesanimals
Wyoming has an unbelievable variety of world class wildlife. From grizzly bears to marmots, golden eagles to cutthroat trout, Wyoming offers something for everyone. BLM lands are vital to big game, up
wildlifeanimals
Image title: Garter snake thamnophis sirtalis eating a toad Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-domain-images-pictures/reptiles-
reptilesanimals
Religion thailand buddhism
architecturefinger
Ouroboros Abake
circularcircle
Animal nature wildlife
animalsnature
Animals wildlife viper
wildlifeanimals
Serpent earrings, Tamil Nadu, India, late 1800s to early 1900s, gold - Freer Gallery of Art - DSC04489
self-published workcc-pd-mark
Musée Camille Claudel 08092019 Gabriel Jules Thomas 1893 Homme combattant un serpent 1 7867
1893 statues in franceself-published work
Amphora with handles of knotted serpents, by Silvio Calci da Velletri, 1638, marble - Galleria Borghese - Rome, Italy - DSC04654
self-published workcc-pd-mark
Musée Camille Claudel 08092019 Gabriel Jules Thomas 1893 Homme combattant un serpent 2 7870
1893 statues in franceself-published work
Billet head in the shape of a sea serpent, from the schooner Diadem, 1855, carved wood with paint and gilt - Cape Ann Museum - Gloucester, MA - DSC01230
yellowfood
Lion and Serpent No 3 by Antoine-Louis Barye, c. 1832, bronze - Middlebury College Museum of Art - Middlebury, VT - DSC08149
self-published workcc-pd-mark
Pot with painted design of serpents, Nasca, La Libertad region, Peru, ceramic - Meso-American collection - Peabody Museum, Harvard University - DSC05956
self-published workcc-pd-mark
Tripod Vase with figures grasping serpents, 700-800 AD, Maya culture, Ulua-Yojoa region, Honduras, earthenware with polychrome slip - Gardiner Museum, Toronto - DSC01164
9th-century pottery in canadabrown
D H Lawrence passport photograph, D. H. Lawrence, 22 February 1929
d. h. lawrence portraitsmodernist literature
Thailand reptile animal
animalsicons
Wiwersheim StCyriaque 75
paintings of the brass serpentgolden painting frames
Underneath the sharon lewis tour
travelfish
Procession of Sultan Süleyman through the Atmeidan, from the frieze Ces Moeurs et fachons de faire de Turcz (Customs and Fashions of the Turks) MET DP146524
ottoman istanbul1553 in art
Hair serpent (jadanagam), Tamil Nadu, India, late 1800s to early 1900s, gold, silver, cotton, rubies - Freer Gallery of Art - DSC04483
autumngold
A Great Blue Heron carrying a garter snake in its mouth getting ready to eat it on the shore of the marsh at Bear River Refuge. Third place winner in Animal Behavior Bear River Refuge Photo Contest 20
animalsbird
Upright serpent, made by Veuve Rust et Dubois, Lyon, France, c. 1830, maple, brass, view 2 - Casadesus Collection of Historic Musical Instruments - Boston Symphony Orchestra - 20180113 175559
self-published workcc-pd-mark
Uroboros
circularcircle
Seljord komm
self-published worksea serpent
Upright serpent, made by Veuve Rust et Dubois, Lyon, France, c. 1830, maple, brass, view 1 - Casadesus Collection of Historic Musical Instruments - Boston Symphony Orchestra - 20180113 175544
self-published workcc-pd-mark
Palanquin fitting of a naga (sacred serpent), Cambodia, Khmer empire, Bayon period, late 1100s AD, gilt bronze - Dallas Museum of Art - DSC04973
self-published workcc-pd-mark
The infant Hercules strangling serpents in his cradle, Pompeo Batoni, 1743
mythological paintings by pompeo batoniclassicism
Religion thailand thailand temple
statuestravel
Background buddha buddhist
backgroundtravel
Spiritual leaf decoration
ornamentsymbol
Background buddha buddhist
backgroundtravel
Serpent effigy, Hopewell culture, Turner Group, Mound 4, altar, Little Miami Valley, Ohio, 200 BC to 500 AD, mica - Native American collection - Peabody Museum, Harvard University - DSC06095
self-published workcc-pd-mark
The Spring, Eurydice Bitten by a Serpent while Picking Flowers (Eurydice's Death), by Eugene Delacroix, 1856-1863, oil on canvas - Museu de Arte de São Paulo - DSC07389
self-published workcc-pd-mark
Snake
reptilesanimals
Kampf der untergehenden Götter by F. W. Heine, Friedrich Wilhelm Heine, Published in 1882.
illustrations of odinillustrations of thor
Wildlife animal nature
animalsnature
Wildlife animal nature
animalsnature
YamataNoOrochi, Toyohara Chikanobu, circa 1870s
yamata no orochiukiyo-e
Très Riches Heures du duc de Berry Folio 25, verso: The Garden of Eden, between 1411 and 1416
très riches heures du duc de berryearly netherlandish painting
Nantucket Sea Serpent, 1937
nantucket sea serpenthistory of nantucket
Serpent eaters (Les mangeurs des serpents), Paul Sérusier, 1894
pont-aven school,les nabis,synthetism,cloisonnism,symbolismpaintings by paul sérusier in the national museum in warsaw
Sea-serpent
serpentsea
Desert slither tongue
animalsicons
The Brazen Serpent, Peter Paul Rubens, between 1635 and 1640
the brazen serpent by rubens (national gallery)flemish baroque painting,baroque
Lair of the Sea Serpent, Elihu Vedder, circa 1899
american paintings in the metropolitan museum of artrealism,symbolism
Immaculate Virgin Victorious over the Serpent of Heresy, Basilio Santa Cruz Pumacallao, from 1670 until 1690
paintings in the museo de arte de limacuzco school
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
At Meydani square, Hippodrome of Constantinople, Serpent Column, Obelisk of Theodosius - Aubry de la Mottraye, Constantinople, 1727
hippodrome of constantinople in artrealism
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Serpent Mound, Kentucky
serpent mound kentucky usa
Frescoes of the Chapel of Eleonora da Toledo in the Palazzo Vecchio in Florence, entrance wall: Adoration of the Cross with the Brazen Serpent, Bronzino, between 1543 and 1545
mannerist paintings in italymannerism
The Sea Serpent (title), George Roux, 1901
illustrations from the sea serpent by george rouxthe sea serpent
Serpent-bonanni
wind instrumentalists in artserpents
Hb serp 2
maps showing history of indigenous peoples of north americaserpent mound
Brass serpent, Emanuel Granberg
reredos in finland1778 paintings
The bronze serpent of Moses, Antoine Masson
brass serpent engravingsantoine masson
The Brazen Serpent, Giovanni Battista Tiepolo, between 1711 and 1770
italian paintings in the statens museum for kunstrococo,baroque
SD35 Serpent Mound Squier and Davis Plate XXXV, 1848
squier and davis imagesserpent mound
Mosque of Sultan Achmet, Luigi Mayer, 1810
sultan ahmed i mosque in artorientalism
Pl. 5: A Serpent Attacking Buoso Donata ['...He ey'd the serpent and the serpent him.' Hell; Canto xxv. line 82.], William Blake, 1827
engravings in the yale center for british artromanticism,fairy painting
Woman bitten by a snake, Auguste Clésinger, 1847
femme piquée par un serpent by auguste clésinger (rf 2053)romanticism
Setting up the serpent (3176658677)
nantucket sea serpent
Moses and the bronze serpent, Jean-Charles Frontier, 1743
jean-charles frontierreligious art
Three Deer & The Serpent
animalsdeer
601 - 700 of 3,003 Next page
/ 31