25,774 Free Photos of D

cc-zerorick d. westvehiclemilitaryaircraftaviationjetpages with mapsarchitectureair force
US Navy 090630-N-9818V-068 Master Chief Petty Officer of the Navy (MCPON) Rick West takes questions during an all-hands call from Seabees and Sailors assigned to Patrol Squadron (VP) 45
rick d. westcamp shields
US Navy 090706-N-9818V-494 Master Chief Petty Officer of the Navy (MCPON) Rick West speaks with U.S. Navy divers at U.S. Naval Ship Repair Facility, Yokosuka
militaryarmy
F-8E(FN) CVN 69 folding wings
militaryaircraft
Flickr - Official U.S. Navy Imagery - An aircraft lands on the flight deck of the USS Dwight D. Eisenhower.
vehiclesea
181224-D-PB383-057 (31511183297)
united service organizations in the 2010skellie pickler
160605-N-WC455-086 (Image 1 of 29) 160605-N-WC455-086
militaryaircraft
161216-N-KK394-296 (32626931745)
peoplearmy
Frankfurt-Fechenheim, Friedhof, Grab B d-18 Schack
self-published workgarden
US Navy 030305-F-3050V-051 Top senior enlisted members during a hearing of the House Appropriations subcommittee on Military Construction
washingtond.c.,
Print of the Eriocnemis godini from A Monograph of the Trochilidae, or family of humming-birds, 6 volumes, large folio (1849-87)d by J. Gould.
animalsbird
Mediterranean port yachts
travelwater
HGK Klaus Meschede 92 80 1266 068-6 D-HGK
passenger trainvehicle
Gell-Munn, Murray (sic), and Neils H. D. Bohr (sic) memorial bricks - Palmer Square - Princeton, NJ - DSC00976
pavementgrey
Frankfurt, Hauptfriedhof, Grab adM 64 Souchay
self-published workpages with maps
Frankfurt, Südfriedhof, D 182, Grab Dörrstein-Fuchs
self-published workfop-germany
Mercer house Cuming Street from SE 2
self-published workarchitecture
Levergies (Aisne) croix de chemin D 21 sur la hauteur
self-published workpages with maps
Main station D,L & W Scranton PA
architecturetown
LufthansaAirbusA321-100registratedD-AIRL
militaryvehicle
KA-3B VAH-10 over USS FD Roosevelt (CVA-42) c1966
militaryvehicle
181223-D-PB383-100 (45522157755)
kellie picklervehicle
NEWPORT NEWS 160818-N-MG976-073
virginiaofficer
RF-8G VFP-206 is towed on USS Eisenhower (CVN-69) 1985
militaryvehicle
Vitrail Chartres-050 d
architecturecolor
Vitrail Chartres-113-d
self-published workarchitecture
US Navy 061219-N-8907D-002 A Sailor with V-2 Division waist safety gives the all clear to launch an F-A-18C Hornet
flight deck of uss dwight d. eisenhower (cvn-69)strike fighter squadron 131 (united states navy)
US Navy 061222-N-5330L-186 Line handlers aboard the guided-missile cruiser USS Anzio (CG 68) wait for the signal to heave the mooring line as Anzio moors into port at United Arab Emirates
aboard uss dwight d. eisenhower (cvn-69)
US Navy 060615-D-2987S-115 Flowers are placed at the original stone of the Pentagon, during a groundbreaking ceremony for the Pentagon Memorial
flowerfacade
US Navy 090330-N-9818V-268 Master Chief Petty Officer of the Navy (MCPON) Rick West stops to speak with Sailors on watch during his tour of the Naval Air Technical Training Center
naval air technical training centerrick d. west
US Navy 090912-N-9818V-471 Master Chief Petty Officer of the Navy (MCPON) Rick West speaks with Sailors aboard the aircraft carrier USS Ronald Reagan (CVN 76)
guests aboard uss ronald reagan (cvn-76)rick d. west
US Navy 090430-N-9818V-024 Master Chief Petty Officer of the Navy (MCPON) Rick West speaks with Sailors from Naval Air Station Whidbey Island attending the Individual Agumentee symposium
naval air station whidbey islandrick d. west
US Navy 091006-N-9818V-131 Master Chief Petty Officer of the Navy (MCPON) Rick West meets with U.S. Marine Lance Cpl. Jeremy Terry
wounded military peoplepeople
US Navy 091118-N-5087R-071 Chief Petty Officer Matthew D. White, and Lt. jg Jason Holbrook try to calm a disgruntled citizen at the mock riot during a field training exercise
united states navy images from virginia beachvirginia
US Navy 100106-N-8273J-325 Master Chief Petty Officer of the Navy (MCPON) Rick West answers questions from Sailors aboard the aircraft carrier USS Nimitz (CVN 68)
guests aboard uss nimitz (cvn-68)rick d. west
U.S. Naval Forces Southern Command, U.S. Fourth Fleet Change of Command 210903-N-RL456-0217
change of command ceremonies of the united states navydonald d. gabrielson
US Navy 110818-N-AU622-036 Lt. Jonathan Cochran and chief petty officers of the flag detail prepare to release cremains to the deep during a burial
aboard uss dwight d. eisenhower (cvn-69)seaside
US Navy 110921-N-CT127-179 Sailors participate in a live-fire exercise on the M-240 machine gun aboard the San Antonio-class amphibious transport d
militaryarmy
US Navy 100422-N-9818V-603 Master Chief Petty Officer of the Navy (MCPON) Rick West and Force Master Chief James Williams talk with Information Systems Technician Seaman Jacob Blizzard at Camp Allen
naval station norfolkrick d. west
US Navy 110714-N-AU622-041 An F-A-18F Super Hornet assigned to the Gladiators of Strike Fighter Squadron (VFA) 106
flight deck of uss dwight d. eisenhower (cvn-69)vehicle
US Navy 120120-N-IT566-020 Adm. Cecil Haney has his new shoulder boards placed on his uniform by his wife and daughter
january 2012 united states photographsgroup
US Navy 111102-N-XQ375-421 The Pakistani navy destroyer PNS Shahjahan (D 186), left, and the guided-missile cruiser USS Mobile Bay (CG 53) transit
general views of uss mobile bay (cg-53)1977
US Navy 111106-N-XE109-058 Aviation Boatswain's Mate (Equipment) Airman Omar D. Harris paints a bulkhead aboard the aircraft carrier USS George H.W
architecturepeople
US Navy 120131-N-SH953-105 Seaman William Gillaspie assists Master Chief Petty Officer of the Navy (MCPON) Rick D. West as he climbs down the main
vehiclewater
US Navy 100729-N-9818V-058 Master Chief Petty Officer of the Navy (MCPON) Rick West addresses Class 154 at the Senior Enlisted Academy (SEA) during his visit to Naval Station Newport
people at naval station newportrick d. west
US Navy 100826-N-9818V-561 Master Chief Petty Officer of the Navy (MCPON) Rick West answers questions from chief petty officers during his visit to Republic of Korea
united states navy images from jinhaerick d. west
US Navy 100609-N-7526R-104 The coin of Master Chief Petty Officer of the Navy (MCPON) Rick West sits amongst hundreds of other military coins
landstuhl regional medical centerrick d. west
Paprastoji dumplūnė (Physalis alkekengi) Foto Algirdas, 2005 m. spalio 5 d.
plantsfood
Si tu es amoureux euse impossible de ne pas ecrire meat
springgrass
Domplatz 14 Eichstätt -D-1-76-123-56
architecturevillage
Cassette case comparison - regular, slim, ultraslim (3)
self-published work3 kinds
Image title: Brook floater and northern lance alasmidonta varicosa and elliptio fisheriana Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-d
animalsmollusk
Cosplay Field Taipei 2015 B Area and D Area 20150628
peoplegroup
Yamato International Tokyo Building
self-published workpages with maps
Yakovlev yak-11 za patrika i luisu
militaryvehicle
Oita Fragrance Museum, Perfumery Organ
self-published workpages with maps
Armored crane moves shipping containers while expanding the ROLE 3 Hospital on Kandahar Airport -d
international security assistance forcemilitary cranes
190812-N-UB406-0450 (48541925031)
oceansea
181222-D-PB383-085 (44606602020)
celebritiesgroup
C-2A landing on USS Eisenhower (CVN-69) 1983
vehiclenavy
French - Reliquary Shrine of St Martial - Walters 44119 - Side D
limoges enamel - 13th centurymedieval reliquaries
Mayan - Bowl - Walters 20092030 - Side D
7th-century pottery in the united statesbrown
US Navy 050216-N-0962S-154 Master Chief Petty Officer of the Navy (MCPON) Terry Scott testifies before the House Appropriations Committee, subcommittee on Military Quality of Life and Veteran's Affairs
people of the united states department of veterans affairsterry d. scott
US Navy 060602-N-0962S-058 Master Chief Petty Officer of the Navy (MCPON) Terry Scott flips through a photo album with seven-year-old Honorary Chief Hospital Corpsman (FMF) Diego Santiago
arlington countyvirginia
US Navy 090707-N-9818V-144 Master Chief Petty Officer of the Navy (MCPON) Rick West visits the K9 Kennel at Naval Air Facility Atsugi, Japan during his visit to the base
people at naval air facility atsugirick d. west
US Navy 101002-N-8335D-023 Damage Controlman 3rd Class Matthew Barrera uses a naval infrared thermal imager to check an engine room for hot spots d
engine rooms of the united states navyaboard uss harpers ferry (lsd-49)
US Navy 120120-N-IT566-277 Adm. Cecil Haney delivers remarks during the U.S. Pacific Fleet change of command ceremony
2012 in pearl harborcecil d. haney
US Navy 111102-N-XQ375-412 The Pakistani navy destroyer PNS Shahjahan (D 186), left, and the guided-missile cruiser USS Mobile Bay (CG 53) transit
general views of uss mobile bay (cg-53)1977
US Navy 050712-N-0962S-136 Three of the Navy's top Command Master Chiefs (CMCs) observe an all hands call by Master Chief Petty Officer of the Navy (MCPON) Terry Scott
terry d. scottgroup
US Navy 100302-N-9818V-039 Master Chief Petty Officer of the Navy (MCPON) Rick West visits Naval Service Training Command headquarters during his visit to Naval Station Great Lakes
naval station great lakesrick d. west
US Navy 100305-N-9818V-094 senior leadership speak congratulate Sailors at the 95th Navy Reserve Anniversary and Reenlistment ceremony
united states navy images from washingtond.c.,
US Navy 091215-N-9818V-034 Master Chief Petty Officer of the Navy (MCPON) Rick West reenlists a chief petty officer before a chief petty officer's call
reenlistmentgroup
US Navy 100108-N-8273J-300 Master Chief Petty Officer of the Navy (MCPON) Rick West meets with Sailors assigned to Role III Hospital at Kandahar Airfield, Afghanistan
militaryarmy
US Navy 100507-N-9818V-071 Master Chief Petty Officer of the Navy (MCPON) Rick West meets Con Crabb on the reviewing stand for the 61st Armed Forces Day Parade
rick d. westgroup
US Navy 100730-N-0569K-020 Machinist's Mate 3rd Class Daniel C. Hansen, left, and Electrician's Mate 3rd Class Chelsea D. Waters to power the pumps that align the aqueous film forming foam
aboard uss enterprise (cvn-65)skateboarding
US Navy 090402-N-9818V-070 Master Chief Petty Officer of the Navy (MCPON) Rick West takes questions from students attending Naval Technical Training Center at Naval Air Station Meridian
naval air station meridianrick d. west
US Navy 090305-N-9818V-110 Master Chief Petty Officer of the Navy (MCPON) Rick West meets with Sailors who recently returned from serving an Individual Augmentee
handshakes involving the militaryrick d. west
US Navy 090602-N-9818V-398 Master Chief Petty Officer of the Navy (MCPON) Rick West addresses guests at a book signing of
edward steichend.c.,
US Navy 070506-N-5330L-002 A plane director signals to the pilot of an F-A-18C Hornet, from the
flight deck of uss dwight d. eisenhower (cvn-69)strike fighter squadron 131 (united states navy)
US Navy 061230-D-1142M-021 Vice President Richard B. Cheney pays tribute to former President Gerald R. Ford during services at the U.S. Capitol Rotunda, Dec. 30, 2006
death and state funeral of gerald forddick cheney in 2006
Village pierre mountains
backgroundlandscape
Plant macro nature
naturespring
Mercedes-Benz 190 D EX-80-01 pic9
vehiclecar
Méréville (Essonne) Croix de chemin D 145
grassfield
Vitrail Chartres-116-d
self-published workcc-pd-mark
MiG-21PF Fishbed D, Czech air force 0308 pic3
militaryvehicle
MiG-21PF Fishbed D, Czech air force 0308 pic2
militaryvehicle
Robin DR.400slash120D DauphinD-EFRS
aircraftflight
Frankfurt, Hauptfriedhof, Grab adM 176 von Meyer
self-published workcc-zero
Frankfurt, Hauptfriedhof, Grab adM 216 von Heyden
self-published workcc-zero
Frankfurt, Hauptfriedhof, Grab adM 178 Rittershausen-Soemmerring
self-published workcc-zero
Frankfurt, Hauptfriedhof, bei Grab C 3 Lyraspielerin
1910 sculptures in frankfurt am mainself-published work
Frankfurt-Niederrad, Friedhof, Grab D 127 Ruhestätte der armen Dienstmägde Jesu Christi 1890-1906
self-published workcc-zero
CRJ900eurowingsD-ACNH
aircraftvehicle
Büttelgasse 4 Eichstätt -D-1-76-123-42
architectureroof
US Navy 110322-N-9643S-082 Sailors aboard the aircraft carrier USS George Washington (CVN 73) scrub the flight deck during a counter-measure wash d
ships at fleet activities yokosukavehicle
US Navy 110322-N-9643S-079 Sailors aboard the aircraft carrier USS George Washington (CVN 73) scrub the flight deck during a counter-measure wash d
wintersnow
D-1-76-114-115
architecturevillage
Buste de Perre-André de Suffren de Saint-Tropez
artworks with wikidata itemself-published work
Dormitory E for Female and Dormitory D at Former ROCAF Headquarters 20140405
sidewalkcity
Vitrail Chartres-127-d
self-published workcc-pd-mark
11101 - 11200 of 25,774 Next page
/ 258