25,774 Free Photos of D

cc-zerovehiclerick d. westpages with mapsaircraftcarmilitarynavyarchitecturecultural heritage monuments in bavaria with known ids
Orange horizon twilight
landscapenature
Nice hell mediteran
trainnice
Bentenjima (Nachikatsuura, Wakayama) 01
watersky
1964 Chrysler Valiant D photo-7
vehiclecar
Curtiss-Wright P-47G-10-CU - TP-47G-CU Thunderbolt 'WZ-D - 225068' (G-CDVX) (26024429018)
militaryvehicle
Koukan dori street 02
trafficcity
SH-3H HS-5 over hovers over USS Eisenhower (CVN-69) 1984
vehiclenavy
F-4S VF-202 launching from USS Eisenhower (CVN-69) 1985
aircraftvehicle
Paprastoji dumplūnė (Physalis alkekengi) Foto Algirdas, 2005 m. spalio 5 d.
plantsleaf
USS STOUT (DDG 55) DEPLOYMENT 2016 161007-N-GP524-498
vehicleboat
US Navy 070320-D-9880W-010 Vice Chairman of the Joint Chiefs of Staff, Adm. Edmund Giambastiani, left, talks with European Union Secretary General and High Representative Javier Solana in the Pentagon while awaiting the arrival
interior of the pentagonedmund p. giambastiani
US Navy 061019-N-5330L-002 A Sailor from the Nimitz-class aircraft carrier USS Dwight D. Eisenhower (CVN 69) takes a photograph of historic buildings during a tour of Rome, Oct. 19
united states navy images from laziotourism in rome
US Navy 101210-N-1261P-007 The aircraft carrier USS Abraham Lincoln (CVN 72), right, and the French navy destroyer Forbin (D 620) are underway toge
vehicleboat
US Navy 050806-N-0962S-232 Master Chief Petty Officer of the Navy (MCPON) Terry Scott speaks to U.S. Navy Sailors and U.S. Coast Guardsmen during an all hands call
terry d. scottpanama
US Navy 100302-N-9818V-348 Master Chief Petty Officer of the Navy (MCPON) Rick West talks to Sailors during a class at the Center for Naval Engineering during his visit to Naval Station Great Lakes
naval station great lakesrick d. west
US Navy 100302-N-9818V-295 Master Chief Petty Officer of the Navy (MCPON) Rick West talks to Sailors during a class at the Center for Naval Engineering during his visit to Naval Station Great Lakes
naval station great lakesrick d. west
US Navy 100302-N-9818V-190 Master Chief Petty Officer of the Navy (MCPON) Rick West talks to Sailors as they prepare to leave for their new duty stations during his visit to Naval Station Great Lakes
naval station great lakesrick d. west
US Navy 100524-N-3595W-001 he guided-missile destroyer USS Farragut (DDG 99) is underway alongside the aircraft carrier USS Dwight D. Eisenhower (CVN 69) during a replenishment at sea
oceansea
US Navy 090504-N-9818V-013 Master Chief Petty Officer of the Navy (MCPON) Rick West and Lt. Cmdr. Michael G. Topping, Sr. pin Master Chief anchors on Shawn Newcoste during a frocking ceremony at the pentagon
interior of the pentagonrick d. west
US Navy 090603-N-9818V-111 Master Chief Petty Officer of the Navy (MCPON) Rick West addresses new petty officers assigned to the Office of the Chief of Naval Operations staff
the pentagon in 2009rick d. west
US Navy 090825-N-9818V-004 Master Chief Petty Officer of the Navy (MCPON) Rick West holds an office call with Debby Greene, Ombudsman-at-Large for the Chief of Naval Operations (CNO)
united states navy images from washingtond.c.,
US Navy 090910-N-9818V-088 Cmdr. Bruce Nevel, commanding officer of Naval Mobile Construction Battalion (NMCB) 74, briefs Master Chief Petty Officer of the Navy (MCPON) Rick West
kandahar province in the war in afghanistan (2001–2014)rick d. west
US Navy 110413-N-ZS026-224 Rear Adm. Margaret Klein alks with Machinist's Mate 1st Class Eric Freemen in the main machinery space of USS Boxer (LHD
aboard uss boxer (lhd-4)group
US Navy 110331-N-9950J-045 Sailors and Marines move supplies on the flight deck of the forward-deployed amphibious assault ship USS Essex (LHD 2) d
underway replenishment2011
US Navy 110722-N-WA347-126 Cmdr. A. D. Hull presents the command ball cap and command coin to Australian Army Gen. David Hurley, chief of Defence F
aboard uss germantown (lsd-42)david hurley
Image title: Enhydra lutris sea otter animal on coast Image from Public domain images website, http://www.public-domain-image.com/full-image/fauna-animals-public-domain-images-pictures/otters-public-d
animalsmammals
Reflections in the water sunset color image
landscapetravel
OSAKA AUTO MESSE 2015 (204) - Daihatsu COPEN XPLAY (LA400K) produced by D SPORT
vehiclecar
No.61 SUBARU BRZ R&D SPORT at 2014 pokka sapporo 1000km (9)
vehiclecar
Vitrail Chartres-137-d
self-published workarchitecture
Plage D Yport Et Vue Du Fécamp (192133021)
watersea
Rebdorfer Str 20 Eichstätt D-1-76-123-206
self-published workpages with maps
Frankfurt, Hauptfriedhof, Grab adM 145 Starck
self-published workcc-zero
Frankfurt, Hauptfriedhof, Grab adM 187 Krieg
self-published workcc-zero
Frankfurt, Hauptfriedhof, Grab adM 188 Reus
self-published workcc-zero
Frankfurt, Hauptfriedhof, Grab C 129 Prösler
self-published workcc-zero
Frankfurt, Hauptfriedhof, Grab adM 141 Lemmé
self-published workcc-zero
Frankfurt, Hauptfriedhof, Grab C 346 Prigge
self-published workcc-zero
Beaurepaire-sur-Sambre (Nord, Fr) chapelle D 116 sortie est
self-published workpages with maps
HMY Britannia underway in July 1959, with Queen Elizabeth II and Dwight D. Eisenhower
vehiclewater
US Navy 110723-N-QL471-036 Seaman Tyler D. Nordland stands lookout watch on vulture's row aboard the aircraft carrier USS George H.W. Bush (CVN 77)
militarynavy
US Navy 120207-N-PB383-656 A landing craft air cushion assigned to Assault Craft Unit (ACU) 5 approaches the welldeck of the amphibious transport d
vehiclesea
US Navy 060518-N-0962S-188 Master Chief Petty Officer of the Navy (MCPON) Terry Scott visits with some of the Navy's newest Sailors as they stand by to receive mooring lines from their shipmates aboard USS Marlinspike on board
uss marlinspiketerry d. scott
US Navy 051012-N-0962S-155 Master Chief Petty Officer of the Navy (MCPON) Terry Scott speaks to Sailors assigned to Beach Master Unit One (BMU-1) during his visit to the Persian Gulf
kuwait naval baseterry d. scott
US Navy 100729-N-9818V-027 Master Chief Petty Officer of the Navy (MCPON) Rick West addresses Class 154 at the Senior Enlisted Academy (SEA) during his visit to Naval Station Newport
people at naval station newportrick d. west
US Navy 100831-N-8590G-011 Cmdr. Paul D. Young presents a certificate of transfer to Capt. Naveed Ashraf during the of USS McInerney (FFG 8) at Naval Station Mayport
decommissioning of uss mcinerney (ffg-8)31 august 2010
US Navy 100908-N-6720T-015 Sailors aboard USS George Washington (CVN 73) man the rails as the ship raises one of its 90,000-pound anchors before d
vehicleship
US Navy 101115-N-3374C-026 A replica of a Curtiss-Ely Pusher is on the flight deck of the aircraft carrier USS George H.W. Bush (CVN 77)
curtiss model dvehicle
USS FD Roosevelt (CVA-42) battle group 1970
aerial escortvehicle
US Navy 090429-N-9818V-036 Lt.j.g. Zach Scheel gives Master Chief Petty Officer of the Navy (MCPON) Rick West a tour of the Charles Luke Milam Bachelor Housing complex at Naval Station Everett
naval station everettrick d. west
US Navy 090429-N-9818V-104 Master Chief Petty Officer of the Navy (MCPON) Rick West poses for a photo with a Sailor before an all-hands call at the Briefing Theater at Naval Station Everett
celebritiesgroup
US Navy 090310-D-5972N-005 U.S. Navy Information Systems Technician 2nd Class James Rago troubleshoots the video teleconference system of a video information exchange system
aboard uss ronald reagan (cvn-76)naval base san diego in the 2000s
US Navy 100925-N-2821G-065 Senior Chief Quartermaster James Fox and Quartermaster 2nd Class Sarah DeGraw, explain surface contact radar aboard the
bridge of the uss abraham lincoln (cvn-72)quartermaster (united states navy)
US Navy 030326-N-7781D-033 On the Flag Bridge of USS Harry S. Truman (CVN-75) Rear Admiral John D. Stufflebeem, Commander Task Force Sixty (CTF-60)
aboard uss harry s. truman (cvn-75)john stufflebeem
PRESERVED_SPECIMEN; ; 70% alc.; microslide; HYPOTYPE. See: Dana, James D. 1854. Catalogue and descriptions of Crustacea collected in California by Dr. John L. Le Conte. Proceedings of the Academy
arthropodaisopoda
® ••- . *** ( ' t) I , O y\ li K VI A V D I ' A R I I 1 ', : /ro/.i .//. i u.ir(.rAiim. . . /
animalsbird
US Navy 100331-N-9818V-076 Master Chief Petty Officer of the Navy (MCPON) Rick West holds an all hands call with Sailors from Navy Information Operations Command
united states navy images from fort meaderick d. west
US Navy 100224-N-3289C-012 U.S. Ambassador to Spain and Andorra, Alan D. Solomont, center, talks with Capt. Bill Mosk, commander of Naval Activities Spain
shoppinginside
US Navy 090817-N-9818V-035 Master Chief Petty Officer of the Navy (MCPON) Rick West speaks with Sailors at the Navy Bachelor Housing complex at Andrews Air Force Base
united states navy images from washingtond.c.,
US Navy 110330-N-4930E-135 Master Chief Petty Officer of the Navy (MCPON) Rick West testifies before the House Committee Subcommittee, Veterans Aff
united states navy images from washingtond.c.,
US Navy 110704-N-XK513-166 Sonar Technician (Surface) 2nd Class Jay D. Au from the High Speed Vessel Swift (HSV 2) congratulates a graduate of Gabo
africa partnership station 2011people
US Navy 090817-N-9818V-063 Master Chief Petty Officer of the Navy (MCPON) Rick West speaks with Sailors at the Navy Bachelor Housing complex at Andrews Air Force Base
united states navy images from washingtond.c.,
US Navy 090716-N-9818V-202 Master Chief Petty Officer of the Navy (MCPON) Rick West addresses the 2009 Sailors of the Year and their guests during a promotion ceremony at the Navy Memorial
united states navy images from washingtond.c.,
US Navy 090916-N-9818V-383 Master Chief Petty Officer of the Navy (MCPON) Rick West reviews the small boat simulator and talks with Sailors assigned to Commander Task Force (CTF) 56
naval support activity bahrainpeople
US Navy 090324-N-9818V-387 Master Chief Petty Officer of the Navy (MCPON) Rick West visits Sailors at Construction Battalion Maintenance Unit (CBMU) 202 at Naval Station Anacostia
naval support facility anacostiaraising hand
US Navy 090330-N-9818V-343 Master Chief Petty Officer of the Navy (MCPON) Rick West sits with Airman Recruit Kelli Neuenswander, Airman Recruit Ashley Hoover and Airman Recruit Rachel Reasey
distinguished guests at nas pensacolarick d. west
F3H-2 of VF-14 on USS FD Roosevelt (CVA-42) in 1960
militaryaircraft
Philippe-Jacques de Loutherbourg-Vue du Havre du côté de la mer
vehiclewater
Ilg und die äthiopische Eisenbahn in Dire Dawa
film photographybw
Vitrail Chartres-127-d
self-published workcc-pd-mark
Wien 02 Karmelitergasse 9 d
self-published workletter
Weißenburger Str 1 Eichstätt -D-1-76-123-260
sidewalkfacade
LufthansaD-AIBClandingTXL
militaryvehicle
Luitpoldstr 10 Eichstätt -D-1-76-123-110
self-published workarchitecture
Keiyou-Rinkai KD55103 with East i-D
self-published workvehicle
Nagada Silex Geneva 21102014 1
template unknown (author)self-published work
No.62 R&D SPORT LEGACY B4 at 2011 Pokka GT Summer Special
automotivecar
Marconi Wireless Telegraph Type D tuner - New England Wireless & Steam Museum - East Greenwich, RI - DSC06690
boxingwood
Mercedes-Benz 300 D (1976), Dutch licecence registration 76-YA-24
vehiclecar
Lyon 9e - Métro ligne D - Station Gorge de Loup - Déconfinement 2020, affiches Merci de garde la distance
self-published workinside
Osaka Motor Show 2013 (129) SUBARU BRZ R&D SPORT
vehiclecar
Front and George streets, Toronto -d
trafficlight
Dormitory E for Female and Dormitory D at Former ROCAF Headquarters 20140405
sidewalkcity
Yakiniku restaurant in Cement street
self-published workpages with maps
Yaesu tunnel
self-published workpages with maps
Prisches (Nord, Fr) N. D. de Prisches, (anciens-catholiques)
villageroof
A-7E VA-12 on USS Eisenhower (CVN-69) 1980
militaryaircraft
Rebdorfer Str 66 Eichstätt D-1-76-123-207
villageroof
Reichenbach (Oberfranken) - Sandsteinmarter Richtung Teuschnitz 1
architecturegrass
170614-F-RH756-425 (34929962290)
baltops 2017aircraft
160704-N-KK394-016 (28017799322)
militaryaircraft
Buste de Perre-André de Suffren de Saint-Tropez
artworks with wikidata itemself-published work
D-1-76-114-115
architecturevillage
Drink beverage ice
summerfood
Hans Holbein d. Ä.-Graue Passion-1054
pd-art (pd-old-auto)cc-pd-mark
Hans Holbein d. Ä.-Graue Passion-1057
pd-art (pd-old-auto)cc-pd-mark
Big city gleise track climb
architecturenice
US Navy 050211-N-0962S-003 Master Chief Petty Officer of the Navy (MCPON) Terry Scott speaks to R. Lee Ermey in the Navy Operations Center at the Pentagon
military people with the national flag of the united states in backgroundterry d. scott
US Navy 050310-D-9880W-084 Four experts on issues related to the handling of detainees from the war on terror, brief reporters on the findings of the Church Report
terrorism in the united statespentagon press briefing room
US Navy 040614-D-9880W-222 Secretary of Defense Donald H. Rumsfeld, right, joins visiting Afghanistan President Hamid Karzai for a press conference
donald rumsfeld in 2004hamid karzai in 2004
11201 - 11300 of 25,774 Next page
/ 258